8D5Q: TCR TG6

TCR TG6 in complex with Ld-HF10. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Sept 2022.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Mus musculus, Toxoplasma gondii
Chains: 4
Atoms: 5,349
Mol. weight: 73.73 kDa
Released: 14 Sept 2022

Explore 8D5Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8D5Q contains 19 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	9-13	5	2
β-strand	18-20	3	3
β-strand	23-25	3	1
β-strand	32-37	6	2
β-strand	44-49	6	2
α-helix	54	1
β-strand	55-58	4	3
β-strand	61-64	4	3
β-strand	66	1	1
β-strand	71	1	1
β-strand	74-76	3	3
α-helix	81-83	3
β-strand	85-91	7	2
α-helix	92-93	2
β-strand	103-104	2	2
β-strand	108-113	6	2
α-helix	114	1
β-strand	122-127	6	4
β-strand	128	1	5
β-strand	135-140	6	4
β-strand	156-158	3	4
β-strand	163-166	4	6
α-helix	167-169	3
β-strand	171-174	4	6
β-strand	175-180	6	4

Chain B: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
β-strand	9-13	5	8
β-strand	18-24	7	7
β-strand	31-38	8	8
β-strand	43-49	7	8
β-strand	55-60	6	7
β-strand	63-71	9	7
β-strand	74-80	7	7
β-strand	86-93	8	8
α-helix	101-102	2
β-strand	103-104	2	8
β-strand	108-113	6	8
α-helix	116-118	3
β-strand	120	1	9
α-helix	121-122	2
β-strand	123-127	5	5
α-helix	128-130	3
α-helix	131-137	7
β-strand	139-149	11	5
β-strand	150	1	9
β-strand	154-160	7	10
β-strand	163-165	3	10
β-strand	169-171	3	5
β-strand	176-177	2	5
β-strand	187-196	10	5
α-helix	197-201	5
β-strand	206-213	8	10
β-strand	216	1	11
β-strand	230	1	11
β-strand	232-239	8	10

Chain C: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-13	11	12
β-strand	21-28	8	12
β-strand	31-37	7	12
β-strand	46-47	2	12
α-helix	50-52	3
α-helix	57-84	28
β-strand	93-103	11	12
β-strand	109-118	10	12
β-strand	121-126	6	12
β-strand	133-135	3	12
α-helix	138-150	13
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-174	10

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TCR-alpha	A	protein	209	Mus musculus
TCR-beta	B	protein	244	Mus musculus
H-2 class I histocompatibility antigen, L-D alpha chain	C	protein	180	Mus musculus	P01897 (AlphaFold model)
Dense granule protein 6, HF10 peptide	E	protein	10	Toxoplasma gondii

Sequence of entity 1 (A), FASTA

>8D5Q_1 TCR-alpha (chains A)
MDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRASRDKEKGSSR
GFEATYNKETTSFHLQKASVQESDSAVYYCALGDPTGANTGKLTFGHGTILRVHPNIQNP
DPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAW
SNKSDFACANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (B), FASTA

>8D5Q_2 TCR-beta (chains B)
MTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKS
LPGADYLATRVTDTELRLQVANMSQGRTLYCTCSAGRGGYAEQFFGPGTRLTVLEDLKNV
FPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQ
PALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAW
GRAD

Sequence of entity 3 (C), FASTA

>8D5Q_3 H-2 class I histocompatibility antigen, L-D alpha chain (chains C)
MGPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEY
WERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYD
GCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATL

Sequence of entity 4 (E), FASTA

>8D5Q_4 Dense granule protein 6, HF10 peptide (chains E)
HPGSVNEFDF

Primary citation

Peptide Centric V beta Specific Germline Contacts Shape a Specialist T Cell Response. Wang, Y., Tsitsiklis, A., Devoe, S. et al. Front Immunol (2022) 13:847092-847092. DOI 10.3389/fimmu.2022.847092 · PubMed

Other PDB entries of the same protein (UniProt P01897 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
6L9K 1.8 Å, H2-Ld a1a2 complexed with A5 peptide
8D5N 1.8 Å, Crystal structure of Ld-HF10
3VJ6 1.9 Å, Structure of the MHC class Ib molecule Qa-1b
4MS8 1.92 Å, 42F3 TCR pCPB9/H-2Ld Complex
3ERY 1.95 Å, Different thermodynamic binding mechanisms and peptide fine specificities associated…
5VCL 2.05 Å, Structure of the Qdm peptide bound to Qa-1a
3TJH 2.12 Å, 42F3-p3A1/H2-Ld complex
2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex

Browse structure collections

About this viewer

MolViewer shows 8D5Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.