8DHM: Human TMEM175

Human TMEM175 in complex with 4-aminopyridine. Determined by electron microscopy at 2.73 Å resolution. Released 23 Nov 2022.

Method: Electron microscopy
Resolution: 2.73 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,798
Mol. weight: 111.59 kDa
Ligands: 4AP
Released: 23 Nov 2022

Explore 8DHM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8DHM contains 44 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 22 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	31-32	2	4
α-helix	34-49	16
α-helix	52-56	5
α-helix	64-101	38
β-strand	104-105	2	4
α-helix	107-120	14
α-helix	123-132	10
α-helix	137-163	27
α-helix	165-167	3
α-helix	170-172	3
β-strand	255-256	2	5
α-helix	258-283	26
α-helix	288-293	6
α-helix	299-304	6
α-helix	307-332	26
β-strand	334	1	6
β-strand	337-338	2	5
α-helix	339-352	14
α-helix	355-361	7
α-helix	369-397	29
α-helix	398-400	3
α-helix	401-404	4
β-strand	405	1	6
α-helix	407-409	3
α-helix	416-439	24
α-helix	441-443	3
α-helix	444-460	17
α-helix	462-475	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endosomal/lysosomal potassium channel TMEM175	A, B	protein	504	Homo sapiens	Q9BSA9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8DHM_1 Endosomal/lysosomal potassium channel TMEM175 (chains A, B)
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI
SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI
TFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL
YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP
SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV
AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQ
QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF
AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA
RPEHPPPAPTGQDDPQSQLLPAPC

Ligands and cofactors

ID	Name	Formula	Copies
4AP	4-aminopyridine	C5 H7 N2	1

Water and common crystallization additives (K) are not listed.

Primary citation

Mechanism of 4-aminopyridine inhibition of the lysosomal channel TMEM175. Oh, S., Stix, R., Zhou, W. et al. Proc Natl Acad Sci U S A (2022) 119:e2208882119-e2208882119. DOI 10.1073/pnas.2208882119 · PubMed

Other PDB entries of the same protein (UniProt Q9BSA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UNL 2.45 Å, Human TMEM175 in an open state
7UNM 2.61 Å, Human TMEM175 in an closed state
6WC9 2.64 Å, Human open state TMEM175 in KCl
9VSQ 2.74 Å, The TUG-891-bound structure of TMEM175
9VSR 2.92 Å, The DCY1040 and TUG-891-bound structure of TMEM175
6WCA 3.03 Å, Human closed state TMEM175 in KCl
6WCB 3.17 Å, Human open state TMEM175 in CsCl
6W8N 3.2 Å, Structure of a trans-membrane protein
6WCC 3.24 Å, Human closed state TMEM175 in CsCl
6W8O 3.4 Å, Structure of an Apo membrane protein
8FYF 3.4 Å, Human TMEM175-LAMP1 transmembrane domain only complex
9VSP 3.4 Å, The DCY1020-bound structure of TMEM175

Browse structure collections

About this viewer

MolViewer shows 8DHM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.