8E0G: Mu-type opioid receptor

Re-refined model of active mu-opioid receptor (PDB 5c1m) as an adduct with BU72. Determined by X-ray diffraction at 2.1 Å resolution. Released 18 Oct 2023.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, Lama glama
Chains: 2
Atoms: 3,509
Mol. weight: 49.4 kDa
Ligands: PO4, CLR, OLC
Released: 18 Oct 2023

Explore 8E0G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8E0G contains 19 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	62-64	3
α-helix	65-92	28
α-helix	93-97	5
α-helix	102-119	18
α-helix	121-130	10
α-helix	136-170	35
α-helix	172-178	7
α-helix	181-205	25
β-strand	206-211	6	1
β-strand	214-219	6	1
α-helix	222	1
α-helix	225-236	12
α-helix	237-242	6
α-helix	243-260	18
α-helix	269-305	37
α-helix	308-310	3
α-helix	312-333	22
α-helix	334-338	5
α-helix	341-344	4

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-9	3	2
β-strand	12-14	3	3
β-strand	20-25	6	2
β-strand	32-39	8	3
α-helix	44-45	2
β-strand	46-51	6	3
β-strand	58-60	3	3
β-strand	68-73	6	2
β-strand	78-83	6	2
α-helix	88-90	3
β-strand	92-99	8	3
β-strand	113-114	2	3
β-strand	118-122	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mu-type opioid receptor	A	protein	296	Mus musculus	P42866 (AlphaFold model)
Nanobody 39	B	protein	125	Lama glama

Sequence of entity 1 (A), FASTA

>8E0G_1 Mu-type opioid receptor (chains A)
GSXSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLA
LADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCH
PVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENL
LKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIV
CWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCF

Sequence of entity 2 (B), FASTA

>8E0G_2 Nanobody 39 (chains B)
QVQLVESGGGLVRPGGSLRLSCVDSERTSYPMGWFRRAPGKEREFVASITWSGIDPTYAD
SVADRFTTSRDVANNTLYLQMNSLKHEDTAVYYCAARAPVXXXXXXXDYDYWGQGTQVTV
SSAAA

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
CLR	Cholesterol	C27 H46 O	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	2

Water and common crystallization additives (PG4, P6G) are not listed.

Primary citation

Reanalysis of a mu opioid receptor crystal structure reveals a covalent adduct with BU72. Munro, T.A. BMC Biol (2023) 21:213-213. DOI 10.1186/s12915-023-01689-w · PubMed

Other PDB entries of the same protein (UniProt P42866 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C1M 2.07 Å, Crystal structure of active mu-opioid receptor bound to the agonist BU72
9O36 2.3 Å, CryoEM structure of mu-opioid receptor - Gi protein complex bound to fluornitrazene (FNZ)
9ODF 2.4 Å, Structure of the MOR/Gi/Lofentanil Complex, GTP-bound G-Primed
9ODN 2.4 Å, Structure of the MOR/Gi/DAMGO Complex, GTP-Bound, G-Primed
7T2G 2.5 Å, CryoEM structure of mu-opioid receptor - Gi protein complex bound to mitragynine…
9ODE 2.5 Å, Structure of the MOR/Gi/Lofentanil Complex, Nucleotide Free
4DKL 2.8 Å, Crystal structure of the mu-opioid receptor bound to a morphinan antagonist
7UL4 2.8 Å, CryoEM Structure of Inactive MOR Bound to Alvimopan and Mb6
9ODM 2.8 Å, Structure of the MOR/Gi/DAMGO Complex, Nucleotide Free, Baseline
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSW 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-Gz-scFv16 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex

Browse structure collections

About this viewer

MolViewer shows 8E0G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.