8E2R: TadAC-1.14

Crystal structure of TadAC-1.14. Determined by X-ray diffraction at 2.22 Å resolution. Released 11 Jan 2023.

Method: X-ray diffraction
Resolution: 2.22 Å
Organism: Escherichia coli
Chains: 2
Atoms: 2,224
Mol. weight: 37.89 kDa
Ligands: ZN
Released: 11 Jan 2023

Explore 8E2R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8E2R contains 11 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	8-24	17
β-strand	31-36	6	1
β-strand	39-45	7	1
α-helix	58-70	13
β-strand	79-84	6	1
α-helix	88-97	10
β-strand	101-106	6	1
α-helix	118-121	4
β-strand	131-134	4	1
α-helix	138-148	11

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	8-24	17
β-strand	31-36	6	2
β-strand	39-45	7	2
α-helix	48-51	4
α-helix	58-70	13
β-strand	79-84	6	2
β-strand	87	1	3
α-helix	88-97	10
β-strand	101-106	6	2
β-strand	116	1	3
α-helix	118-120	3
β-strand	131-134	4	2
α-helix	138-149	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
tRNA-specific adenosine deaminase 1.14	A, B	protein	167	Escherichia coli	P68398 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8E2R_1 tRNA-specific adenosine deaminase 1.14 (chains A, B)
MHEVEFSHEYWMRHALTLAKRARDEREVPVGAVLVLNNRVIGEGWNRAKGLHDPTAHAEI
MALRQGGLVMQNYRLIDATLYSTFEPCVMCAGAMIHSRIGRVVFGVRNAKTHAAGSLMDV
LHHPGMNHRVEITEGILADECAALLCRFFRMPRRVFNAQKKAQSSTD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Improved cytosine base editors generated from TadA variants. Lam, D.K., Feliciano, P.R., Arif, A. et al. Nat Biotechnol (2023) 41:686-697. DOI 10.1038/s41587-022-01611-9 · PubMed

Other PDB entries of the same protein (UniProt P68398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Z3A 2.03 Å, Crystal structure of tRNA adenosine deaminase TadA from Escherichia coli
8E2Q 2.34 Å, Crystal structure of TadAC-1.17 in a complex with ssDNA
8E2P 2.72 Å, Crystal structure of TadA*8.20 in a complex with ssDNA
8E2S 2.95 Å, Crystal structure of TadAC-1.19
6VPC 3.2 Å, Structure of the SpCas9 DNA adenine base editor - ABE8e

Browse structure collections

About this viewer

MolViewer shows 8E2R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.