8ENU: C3bB proconvertase

Structure of the C3bB proconvertase in complex with lufaxin. Determined by electron microscopy at 3.22 Å resolution. Released 9 Aug 2023.

Method: Electron microscopy
Resolution: 3.22 Å
Organisms: Homo sapiens, Lutzomyia longipalpis
Chains: 4
Atoms: 20,110
Mol. weight: 296.15 kDa
Ligands: NAG
Released: 9 Aug 2023

Explore 8ENU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ENU contains 70 α-helices and 174 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	47
β-strand	15-23	9	47
β-strand	36-39	4	48
β-strand	44-47	4	48
β-strand	54-64	11	47
β-strand	77-82	6	48
β-strand	89-93	5	48
β-strand	101-110	10	47
β-strand	128	1	49
α-helix	133	1
β-strand	134	1	49
α-helix	135	1
β-strand	137-138	2	50
β-strand	143-144	2	50
β-strand	151-152	2	51
β-strand	162-164	3	51
β-strand	167-172	6	51
β-strand	176	1	50
β-strand	180-187	8	51
α-helix	189-191	3
β-strand	195-201	7	52
α-helix	204-206	3
β-strand	208-217	10	51
β-strand	228-230	3	52
β-strand	241-247	7	52
β-strand	252-261	10	51

Chain D: 26 helices, 51 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	30
β-strand	23-27	5	31
β-strand	32-36	5	31
β-strand	41-44	4	30
β-strand	48-50	3	31
β-strand	51	1	32
β-strand	57	1	32
α-helix	58-59	2
β-strand	72-75	4	30
α-helix	76	1
β-strand	78	1	33
β-strand	87-90	4	34
β-strand	96	1	33
β-strand	101-106	6	34
β-strand	111-113	3	35
β-strand	117-119	3	34
β-strand	120	1	36
β-strand	126	1	36
α-helix	130-131	2
β-strand	132-134	3	35
β-strand	149-152	4	37
β-strand	161-166	6	37
β-strand	171-173	3	38
β-strand	177-179	3	37
β-strand	180	1	39
β-strand	186	1	39
α-helix	189-191	3
β-strand	192-194	3	38
α-helix	202-213	12
β-strand	215-216	2	40
β-strand	234-235	2	40
β-strand	244-251	8	41
α-helix	264-275	12
α-helix	276-278	3
β-strand	283-289	7	41
β-strand	293-297	5	41
α-helix	307-314	8
α-helix	330-341	12
β-strand	356-361	6	41
α-helix	374-383	10
α-helix	395-397	3
β-strand	398-402	5	41
β-strand	405	1	42
α-helix	411-417	7
β-strand	427	1	41
β-strand	430	1	42
α-helix	433-446	14
β-strand	471-478	8	43
β-strand	481-490	10	43
β-strand	495-499	5	43
α-helix	509-511	3
β-strand	512-516	5	43
β-strand	525-530	6	43
α-helix	540-542	3
β-strand	552-557	6	43
α-helix	560-563	4
β-strand	571	1	44
β-strand	575	1	45
α-helix	576-581	6
α-helix	590-597	8
β-strand	602-610	9	44
β-strand	615-623	9	44
α-helix	626-633	8
α-helix	634-637	4
α-helix	647-650	4
β-strand	655-659	5	44
β-strand	660	1	46
β-strand	666	1	46
α-helix	667-670	4
α-helix	671-673	3
α-helix	676	1
β-strand	677-682	6	44
β-strand	685-695	11	44
α-helix	700-702	3
β-strand	714-719	6	44
α-helix	724-730	7
β-strand	738	1	45

Chain G: 11 helices, 48 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	11-13	3	2
β-strand	18-20	3	3
β-strand	21-24	4	1
β-strand	32-39	8	2
β-strand	48-53	6	2
α-helix	56-58	3
β-strand	64-66	3	3
β-strand	83-89	7	2
β-strand	94-102	9	2
β-strand	106-112	7	4
β-strand	116-117	2	5
β-strand	122-131	10	4
β-strand	136	1	4
β-strand	140-146	7	5
β-strand	152-159	8	5
β-strand	166-172	7	4
α-helix	173-174	2
β-strand	180-188	9	5
β-strand	196-202	7	5
β-strand	210-216	7	6
β-strand	221	1	7
β-strand	229-237	9	6
β-strand	242	1	6
β-strand	245-255	11	8
β-strand	258-261	4	8
α-helix	263-265	3
β-strand	267-271	5	8
β-strand	278-280	3	6
α-helix	282-288	7
α-helix	294-297	4
β-strand	301-310	10	8
β-strand	317-325	9	8
β-strand	326	1	7
β-strand	332-334	3	9
β-strand	341-342	2	10
β-strand	348-355	8	9
β-strand	361	1	9
β-strand	368	1	11
β-strand	384-389	6	9
β-strand	403	1	11
α-helix	411-413	3
β-strand	422-423	2	10
α-helix	427-429	3
β-strand	433-435	3	12
β-strand	447-456	10	12
α-helix	462-464	3
β-strand	467-474	8	13
β-strand	477-485	9	13
β-strand	492-499	8	12
β-strand	506-516	11	13
β-strand	522-532	11	13
β-strand	542-545	4	14
β-strand	558-565	8	14
β-strand	569-577	9	15
α-helix	578-583	6
α-helix	591-600	10
α-helix	613-620	8
β-strand	622-626	5	1

Chain H: 29 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	742	1	16
β-strand	748-755	8	15
α-helix	759-760	2
β-strand	761	1	17
β-strand	764	1	17
β-strand	765-772	8	14
β-strand	779-788	10	15
β-strand	793-795	3	15
α-helix	796-798	3
β-strand	799-802	4	15
β-strand	807-812	6	18
β-strand	816-818	3	16
β-strand	823-831	9	18
β-strand	838-843	6	16
β-strand	850	1	19
β-strand	862-866	5	16
β-strand	870-871	2	18
β-strand	874-878	5	18
β-strand	880	1	19
β-strand	884-894	11	16
β-strand	900-910	11	16
β-strand	914-924	11	20
β-strand	938-940	3	21
α-helix	941-943	3
β-strand	948	1	20
α-helix	949	1
β-strand	955-961	7	20
α-helix	975-978	4
α-helix	989-1009	21
α-helix	1012-1014	3
α-helix	1019-1036	18
β-strand	1038	1	22
β-strand	1044	1	22
α-helix	1051-1053	3
α-helix	1054-1066	13
α-helix	1076-1083	8
α-helix	1084-1088	5
α-helix	1109-1111	3
α-helix	1117-1136	20
α-helix	1143-1156	14
α-helix	1164-1177	14
α-helix	1183-1186	4
α-helix	1187-1191	5
α-helix	1193-1195	3
α-helix	1205-1221	17
α-helix	1227-1235	9
α-helix	1248-1263	16
β-strand	1271-1278	8	21
β-strand	1281-1290	10	21
β-strand	1298-1302	5	20
β-strand	1308-1315	8	21
β-strand	1319-1328	10	20
β-strand	1339	1	23
β-strand	1342-1346	5	24
β-strand	1363-1368	6	24
β-strand	1370	1	23
β-strand	1376	1	25
β-strand	1379-1384	6	26
β-strand	1389-1391	3	27
α-helix	1393-1401	9
β-strand	1405-1406	2	26
α-helix	1409-1412	4
β-strand	1421-1426	6	26
β-strand	1429	1	25
β-strand	1435-1440	6	24
β-strand	1441-1443	3	27
β-strand	1453-1459	7	26
β-strand	1467-1471	5	26
β-strand	1484	1	28
β-strand	1489	1	28
α-helix	1507-1514	8
β-strand	1519-1531	13	29
β-strand	1537-1548	12	29
β-strand	1560-1564	5	29
α-helix	1568-1571	4
β-strand	1579-1585	7	29
α-helix	1586-1588	3
β-strand	1589-1592	4	29
β-strand	1595-1599	5	29
β-strand	1605-1608	4	29
α-helix	1612-1615	4
α-helix	1618-1636	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C3 beta chain	G	protein	645	Homo sapiens	P01024 (AlphaFold model)
Complement C3b alpha' chain	H	protein	915	Homo sapiens	P01024 (AlphaFold model)
Complement factor B	D	protein	763	Homo sapiens	P00751 (AlphaFold model)
Lufaxin	A	protein	278	Lutzomyia longipalpis	Q5WPU8 (AlphaFold model)

Sequence of entity 1 (G), FASTA

>8ENU_1 Complement C3 beta chain (chains G)
SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNH
MGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPG
STVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMG
QWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYG
KKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGK
SLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGS
PAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQ
ALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLK
AGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGS
LVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEK
ADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAA

Sequence of entity 2 (H), FASTA

>8ENU_2 Complement C3b alpha' chain (chains H)
SNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVS
MSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLH
NPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKS
LKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVA
QMTEDAVDAERLKHLIVTPSGCGEENMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALEL
IKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLI
LEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGS
ITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLY
NVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPD
HQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMY
HAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMM
TGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFN
VELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVT
LEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPI
KCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQD
LGAFTESMVVFGCPN

Sequence of entity 3 (D), FASTA

>8ENU_3 Complement factor B (chains D)
GSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEYV
CPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPYY
NVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQY
RLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTET
IEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVA
SYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQA
VYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRED
YLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMV
WEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSV
GGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTE
GTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQ
YAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGV
VDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL

Sequence of entity 4 (A), FASTA

>8ENU_4 Lufaxin (chains A)
DGDEYFIGKYKEKDETLFFASYGLKRDPCQIVLGYKCSNNQTHFVLNFKTNKKSCISAIK
LTSYPKINQNSDLTRNLYCQTGGIGTDNCKLVFKKRKRQIAANIEIYGIPAKKCSFKDRY
IGADPLHVDSYGLSYQFDQEHGWNLERNNIFKDTRFSTEVFYHKNGLFNTQITYLAEEDS
FSEAREITAKDIKKKFSIILPNEEYKRISFLDVYWFQETMRKKPKYPYIHYNGECSNENK
TCELVFDTDELMTYALVKVFTNPESDGSRLKEEDLGRG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

A bispecific inhibitor of complement and coagulation blocks activation in complementopathy models via a novel mechanism. Andersen, J.F., Lei, H., Strayer, E.C. et al. Blood (2023) 141:3109-3121. DOI 10.1182/blood.2022019359 · PubMed

Other PDB entries of the same protein (UniProt P01024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WY7 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
2WY8 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
7UE9 1.75 Å, Structure of anti-C3d Fab(3d8b) in complex with C3d
1C3D 1.8 Å, X-ray crystal structure of C3D: a C3 fragment and ligand for complement receptor 2
6RMT 2.0 Å, Crystal structure of disulphide-linked human C3d dimer
7BAG 2.0 Å, C3b in complex with CP40
1GHQ 2.04 Å, CR2-C3D complex structure
3D5R 2.1 Å, Crystal Structure of Efb-C (N138A) / C3d Complex
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4I6O 2.14 Å, Crystal structure of chemically synthesized human anaphylatoxin C3a
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
2GOX 2.2 Å, Crystal structure of Efb-C / C3d Complex

Browse structure collections

About this viewer

MolViewer shows 8ENU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.