8EPA: Interleukin receptor common gamma chain

Structure of interleukin receptor common gamma chain (IL2Rgamma) in complex with two antibodies. Determined by electron microscopy at 3.4 Å resolution. Released 25 Jan 2023.

Method: Electron microscopy
Resolution: 3.4 Å
Organisms: Homo sapiens, Mus musculus
Chains: 5
Atoms: 5,045
Mol. weight: 125.76 kDa
Released: 25 Jan 2023

Explore 8EPA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8EPA contains 8 α-helices and 64 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	13
β-strand	11-12	2	14
β-strand	17-25	9	13
α-helix	29-31	3
β-strand	34-39	6	15
β-strand	45-50	6	15
β-strand	71-73	3	13
β-strand	78-84	7	13
α-helix	88-90	3
β-strand	92-99	8	15
β-strand	110-111	2	15
β-strand	115-118	4	15
β-strand	119-120	2	14

Chain B: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	16
β-strand	10-11	2	17
β-strand	21-22	2	18
β-strand	24-25	2	16
β-strand	34	1	19
β-strand	35-37	3	20
β-strand	38	1	21
β-strand	45-48	4	20
β-strand	62-65	4	18
β-strand	72-75	4	18
β-strand	85	1	21
β-strand	89	1	19
α-helix	96	1
β-strand	103-104	2	17

Chain H: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	5
β-strand	11-12	2	6
β-strand	17-25	9	5
β-strand	33-39	7	7
β-strand	45-52	8	7
β-strand	56-59	4	7
β-strand	69-73	5	5
β-strand	78-84	7	5
β-strand	92-101	10	7
β-strand	106-111	6	7
β-strand	115-117	3	7
β-strand	118-119	2	6

Chain I: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	39-43	5	1
β-strand	47-51	5	1
β-strand	64-68	5	2
β-strand	78-79	2	2
β-strand	94-96	3	1
α-helix	97-99	3
β-strand	105-111	7	2
β-strand	119-125	7	2
α-helix	126-128	3
β-strand	130	1	1
α-helix	132-135	4
β-strand	136-141	6	3
β-strand	148-153	6	3
β-strand	162-167	6	4
β-strand	176-180	5	4
β-strand	185-188	4	3
β-strand	198-204	7	4
α-helix	215-218	4
β-strand	222-223	2	4

Chain L: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	8
β-strand	12	1	9
β-strand	18-22	5	10
β-strand	25	1	8
β-strand	34-38	5	11
β-strand	48	1	11
β-strand	63-64	2	10
β-strand	72-76	5	10
β-strand	85-89	5	11
β-strand	90	1	12
α-helix	96	1
β-strand	97	1	12
β-strand	102	1	11
β-strand	105	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytokine receptor common subunit gamma	I	protein	268	Homo sapiens	P31785 (AlphaFold model)
REGN7257 Fab heavy chain	H	protein	220	Mus musculus
REGN7257 Fab light chain	L	protein	214	Mus musculus
REGN9432 Fab heavy chain	A	protein	221	Mus musculus
REGN9432 Fab light chain	B	protein	214	Mus musculus

Sequence of entity 1 (I), FASTA

>8EPA_1 Cytokine receptor common subunit gamma (chains I)
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQP
TNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQA
TQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSV
DYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEA
EQKLISEEDLGGEQKLISEEDLHHHHHH

Sequence of entity 2 (H), FASTA

>8EPA_2 REGN7257 Fab heavy chain (chains H)
EVQLVESGGGLVQPGGSLRLSCAASGFIFSSYEMHWVRQAPGKGLEWISYISSSGTTIYY
ADSVKGRFTISRDNAKNSLYLHMNSLRAEDTAVYYCTRARITGTFDVFDIWGQGTMVTVS
SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE

Sequence of entity 3 (L), FASTA

>8EPA_3 REGN7257 Fab light chain (chains L)
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIFAASNLQSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQNYNIPYTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (A), FASTA

>8EPA_4 REGN9432 Fab heavy chain (chains A)
EVQLVESGGGVVRPGGSLRLSCAASGFTFDDFDMSWVRQGPGKGLEWVSGINWHGSSTGY
ADSVKGRFTISRDNAKNSLYLQMSSLRAEDTALYHCVRGGTIVGATTPLDYWGQGTLVTV
SSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE

Sequence of entity 5 (B), FASTA

>8EPA_5 REGN9432 Fab light chain (chains B)
DIQMTQSPSSLSASVGDRVTMTCRASRTISSYLSWYQQKSGKVPNLLIFGASSLQSGVPS
RFSASGSGTDFTLIISSLQPEDFATYYCQQSYSSPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Blocking common gamma chain cytokine signaling ameliorates T cell-mediated pathogenesis in disease models. Le Floc'h, A., Nagashima, K., Birchard, D. et al. Sci Transl Med (2023) 15:eabo0205-eabo0205. DOI 10.1126/scitranslmed.abo0205 · PubMed

Other PDB entries of the same protein (UniProt P31785 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E2T 2.28 Å, Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg
2B5I 2.3 Å, cytokine receptor complex
5M5E 2.3 Å, Crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor
4GS7 2.35 Å, Structure of the Interleukin-15 quaternary complex
7S2R 2.49 Å, nanobody bound to IL-2Rg
9JQT 2.7 Å, Structure of interleukin receptor common gamma chain (IL2Rgamma/CD132) in complex with 2D4
8ENT 2.83 Å, Interleukin-21 signaling complex with IL-21R and IL-2Rg
3BPL 2.93 Å, Crystal structure of the IL4-IL4R-Common Gamma ternary complex
9KMC 2.97 Å, Cryo-EM structure of the heterotrimeric interleukin-2 receptor in complex with…
2ERJ 3.0 Å, Crystal structure of the heterotrimeric interleukin-2 receptor in complex with…
6OEL 3.1 Å, Engineered Fab bound to IL-4 receptor
3QB7 3.25 Å, Interleukin-4 mutant RGA bound to cytokine receptor common gamma

Browse structure collections

About this viewer

MolViewer shows 8EPA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.