9JQT: Interleukin receptor common gamma chain

Structure of interleukin receptor common gamma chain (IL2Rgamma/CD132) in complex with 2D4. Determined by electron microscopy at 2.7 Å resolution. Released 18 Dec 2024.

Method: Electron microscopy
Resolution: 2.7 Å
Organisms: Homo sapiens, Lama glama
Chains: 4
Atoms: 5,669
Mol. weight: 88.92 kDa
Released: 18 Dec 2024

Explore 9JQT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JQT contains 24 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	56-60	5
β-strand	61-65	5	1
β-strand	69-73	5	1
α-helix	76-78	3
β-strand	86-91	6	2
α-helix	99	1
β-strand	100-101	2	2
α-helix	102	1
β-strand	105-108	4	1
β-strand	111-117	7	1
α-helix	119-121	3
β-strand	127-133	7	2
β-strand	141-147	7	2
α-helix	148-150	3
β-strand	152-153	2	1
α-helix	154-157	4
β-strand	158-163	6	3
β-strand	170-175	6	3
β-strand	183-190	8	4
β-strand	198-202	5	4
β-strand	207-210	4	3
β-strand	220-227	8	4
α-helix	237-243	7
β-strand	244-245	2	4

Chain B: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	5
α-helix	7-9	3
β-strand	10-12	3	6
β-strand	18-25	8	5
α-helix	29-31	3
β-strand	33-39	7	6
β-strand	45-52	8	6
β-strand	57-60	4	6
β-strand	68-73	6	5
β-strand	78-83	6	5
α-helix	88-90	3
β-strand	92-99	8	6
β-strand	106-107	2	6
β-strand	111-115	5	6
β-strand	121	1	7
β-strand	124-128	5	8
β-strand	139-149	11	8
β-strand	150	1	7
β-strand	155-158	4	9
α-helix	159-161	3
β-strand	163	1	9
β-strand	168-169	2	8
α-helix	170-172	3
β-strand	173-174	2	8
β-strand	180-189	10	8
α-helix	190-192	3
β-strand	199-204	6	9
α-helix	205-207	3
β-strand	209-214	6	9

Chain C: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	10
β-strand	10-13	4	11
β-strand	19-25	7	10
β-strand	33-37	5	11
β-strand	44-48	5	11
β-strand	52-53	2	11
β-strand	61-66	6	10
β-strand	69-74	6	10
α-helix	79-81	3
β-strand	84-89	6	11
α-helix	95	1
β-strand	96-97	2	11
β-strand	98	1	10
β-strand	101-105	5	11
β-strand	110	1	12
α-helix	111-112	2
β-strand	113-117	5	13
α-helix	118-120	3
α-helix	121-126	6
β-strand	128-138	11	13
β-strand	139	1	12
β-strand	143-149	7	14
β-strand	152-154	3	14
β-strand	158-162	5	13
α-helix	163-166	4
β-strand	172-181	10	13
α-helix	182-187	6
β-strand	191-197	7	14
β-strand	204-207	4	14

Chain D: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-9	3	15
β-strand	13	1	16
β-strand	20-25	6	15
α-helix	31-33	3
β-strand	35-41	7	17
β-strand	47-53	7	17
β-strand	60-62	3	17
β-strand	71-75	5	15
β-strand	80-85	6	15
α-helix	90-92	3
β-strand	94-101	8	17
β-strand	110-113	4	17
β-strand	117-119	3	17
β-strand	120	1	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytokine receptor common subunit gamma	A	protein	240	Homo sapiens	P31785 (AlphaFold model)
2D4-Heavy Chain	B	protein	215	Homo sapiens
2D4-Light Chain	C	protein	213	Homo sapiens
Anti-Fab nanobody	D	protein	129	Lama glama

Sequence of entity 1 (A), FASTA

>9JQT_1 Cytokine receptor common subunit gamma (chains A)
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQP
TNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQA
TQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSV
DYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEA

Sequence of entity 2 (B), FASTA

>9JQT_2 2D4-Heavy Chain (chains B)
QVQLVQSGAEVKKPGSSVKVSCKTSGFNIEDIYLHWVRQAPGQGLEWMGRIDPANGKSNY
DPKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCAALRFFGLDYWGQGTLVTVSSAST
KGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV

Sequence of entity 3 (C), FASTA

>9JQT_3 2D4-Light Chain (chains C)
EIVLTQSPATLSLSPGERATLSCRATSSVSYMYWYQQKPGQAPELLIYRTSNLASGIPAR
FSGSGSGTDYTLTISSLEPEDFAVYYCQQWSSNPPTFGQGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (D), FASTA

>9JQT_4 Anti-Fab nanobody (chains D)
GSQVQLQESGGGLVQPGGSLRLSCAASGRTISRYAMSWFRQAPGKEREFVAVARRSGDGA
FYADSVQGRFTVSRDDAKNTVYLQMNSLKPEDTAVYYCAIDSDTFYSGSYDYWGQGTQVT
VSSHHHHHH

Primary citation

2D4, a humanized monoclonal antibody targeting CD132, is a promising treatment for systemic lupus erythematosus. Yin, H., Li, L., Feng, X. et al. Signal Transduct Target Ther (2024) 9:323-323. DOI 10.1038/s41392-024-02017-6 · PubMed

Other PDB entries of the same protein (UniProt P31785 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E2T 2.28 Å, Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg
2B5I 2.3 Å, cytokine receptor complex
5M5E 2.3 Å, Crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor
4GS7 2.35 Å, Structure of the Interleukin-15 quaternary complex
7S2R 2.49 Å, nanobody bound to IL-2Rg
8ENT 2.83 Å, Interleukin-21 signaling complex with IL-21R and IL-2Rg
3BPL 2.93 Å, Crystal structure of the IL4-IL4R-Common Gamma ternary complex
9KMC 2.97 Å, Cryo-EM structure of the heterotrimeric interleukin-2 receptor in complex with…
2ERJ 3.0 Å, Crystal structure of the heterotrimeric interleukin-2 receptor in complex with…
6OEL 3.1 Å, Engineered Fab bound to IL-4 receptor
3QB7 3.25 Å, Interleukin-4 mutant RGA bound to cytokine receptor common gamma
8EPA 3.4 Å, Structure of interleukin receptor common gamma chain (IL2Rgamma) in complex with two…

Browse structure collections

About this viewer

MolViewer shows 9JQT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.