8ESA: HLA-A2

CryoEM structure of HLA-A2 bound to MAGEA4 (230-239) peptide. Determined by electron microscopy at 3.4 Å resolution. Released 3 May 2023.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,140
Mol. weight: 150.92 kDa
Released: 3 May 2023

Explore 8ESA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ESA contains 7 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
α-helix	20-21	2
β-strand	23-28	6	1
β-strand	31-34	4	1
β-strand	47	1	1
α-helix	57-84	28
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-125	5	1
β-strand	126	1	2
β-strand	133	1	2
α-helix	138-147	10
α-helix	152-158	7
α-helix	159-164	6
α-helix	165-174	10
β-strand	183	1	3
α-helix	184-185	2
β-strand	186-190	5	4
β-strand	198-208	11	4
β-strand	209	1	3
β-strand	214-219	6	5
β-strand	222-223	2	5
β-strand	229-230	2	4
β-strand	234-235	2	4
β-strand	241-250	10	4
β-strand	258-262	5	5
β-strand	270-272	3	5

Chain B: 0 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	6
β-strand	6-11	6	7
β-strand	21-28	8	7
β-strand	31	1	6
β-strand	36	1	8
β-strand	39-41	3	9
β-strand	44-45	2	9
β-strand	50-51	2	7
β-strand	55-56	2	7
β-strand	62-63	2	7
β-strand	66-70	5	7
β-strand	78-82	5	9
β-strand	83	1	8
β-strand	91-94	4	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-2-microglobulin,HLA class I antigen,MAGE-A4 peptide chimera	A, B, C	protein	448	Homo sapiens	P61769 (AlphaFold model), Q53Z42 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8ESA_1 Beta-2-microglobulin,HLA class I antigen,MAGE-A4 peptide chimera (chains A, B, C)
GVYDGREHTVGCGGSGGGGSGGGGSIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDI
EVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKW
DRDMGGGGSGGGGSGGGGSGGGGSGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGCYNQSEAGSHTVQ
RMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQL
RAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEP
EQKLISEEDLGGEQKLISEEDLHHHHHH

Primary citation

Structural analysis of cancer-relevant TCR-CD3 and peptide-MHC complexes by cryoEM. Saotome, K., Dudgeon, D., Colotti, K. et al. Nat Commun (2023) 14:2401-2401. DOI 10.1038/s41467-023-37532-7 · PubMed

Other PDB entries of the same protein (UniProt P61769 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4E0K 0.97 Å, Crystal Structure of the amyloid-fibril forming peptide KDWSFY derived from human Beta 2…
1K5N 1.09 Å, HLA-B*2709 bound to nona-peptide M9
3MRE 1.1 Å, Crystal Structure of MHC class I HLA-A2 molecule complexed with EBV bmlf1-280-288…
2YXF 1.13 Å, The high resolution crystal structure of beta2-microglobulin under physiological…
8E2Z 1.13 Å, Structures of HLA-B8E76C loaded with long peptides reveal novel features at the…
7NMR 1.15 Å, Crystal structure of beta-2-microglobulin D76S mutant
8ROP 1.15 Å, Crystal structure of HLA B*18:01 in complex with QEIRTFSF, an 8-mer epitope from…
7R7W 1.17 Å, Crystal structure of HLA-B*5301 complex with an HIV-1 Gag-derived epitope QW9 S3T variant
4U1M 1.18 Å, HLA class I micropolymorphisms determine peptide-HLA landscape and dictate differential…
3CZF 1.2 Å, Crystal structure of HLA-B*2709 complexed with the glucagon receptor (GR) peptide…
6Y26 1.2 Å, Crystal structure of HLA-B2705 complexed with the nona-peptide mA
7NMC 1.2 Å, Crystal structure of beta-2-microglobulin D76E mutant

Browse structure collections

About this viewer

MolViewer shows 8ESA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.