8FJ0: Evasin P1243

Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL2. Determined by X-ray diffraction at 2.91 Å resolution. Released 29 Mar 2023.

Method: X-ray diffraction
Resolution: 2.91 Å
Organisms: Amblyomma americanum, Homo sapiens
Chains: 6
Atoms: 2,886
Mol. weight: 59.65 kDa
Released: 29 Mar 2023

Explore 8FJ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FJ0 contains 14 α-helices and 44 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	28-29	2	1
β-strand	31	1	2
β-strand	32-33	2	3
β-strand	40	1	2
β-strand	41-42	2	4
β-strand	45-48	4	5
β-strand	51-54	4	5
α-helix	55-56	2
β-strand	60-63	4	4
α-helix	66-70	5
β-strand	79-86	8	4
β-strand	89-98	10	4
β-strand	99-100	2	3

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	31	1	6
β-strand	32-33	2	7
β-strand	40	1	6
β-strand	41-42	2	8
β-strand	45-48	4	9
β-strand	51-54	4	9
α-helix	55-56	2
β-strand	60-63	4	8
α-helix	66-70	5
β-strand	79-86	8	8
β-strand	89-98	10	8
β-strand	99-100	2	7

Chain C: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	28-29	2	10
β-strand	31	1	11
β-strand	32-33	2	12
β-strand	40	1	11
β-strand	41-42	2	12
β-strand	45-48	4	13
β-strand	51-54	4	13
α-helix	55-56	2
β-strand	60-63	4	12
α-helix	66-70	5
β-strand	78-86	9	12
β-strand	89-100	12	12

Chain D: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
α-helix	22-24	3
β-strand	25-29	5	14
β-strand	31	1	15
β-strand	41-45	5	14
β-strand	50-53	4	14
α-helix	58-68	11

Chain E: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-29	5	17
β-strand	31	1	15
α-helix	33-35	3
β-strand	41-45	5	17
β-strand	50-53	4	17
α-helix	58-68	11

Chain F: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	10
α-helix	22-24	3
β-strand	25-31	7	16
β-strand	41-45	5	16
β-strand	50-53	4	16
α-helix	58-68	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin P1243	A, B, C	protein	103	Amblyomma americanum	A0A0C9S461 (AlphaFold model)
C-C motif chemokine 2	D, E, F	protein	76	Homo sapiens	P13500 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8FJ0_1 Evasin P1243 (chains A, B, C)
GSTSARNHTEDNSTEYYDYEEARCACPARHLNNTNGTVLKLLGCHAFCNGTLCTAPDGYP
CYNLTAQQVRTLTTYPNTSCAVGVCMKGTCVKNGTMEQCFKTP

Sequence of entity 2 (D, E, F), FASTA

>8FJ0_2 C-C motif chemokine 2 (chains D, E, F)
QPDAINAAVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWV
QDSMDHLDKQTQTPKT

Primary citation

Engineering broad-spectrum inhibitors of inflammatory chemokines from subclass A3 tick evasins. Devkota, S.R., Aryal, P., Pokhrel, R. et al. Nat Commun (2023) 14:4204-4204. DOI 10.1038/s41467-023-39879-3 · PubMed

Other PDB entries of the same protein (UniProt A0A0C9S461 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SCS 1.51 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL11
8FK6 1.74 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(Y44A) Complexed to Human Chemokine CCL7
7SCT 1.84 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL16
7SCU 1.86 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7
8FK8 1.96 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL7
7SCV 2.01 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL17
8FJ2 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(C8) Complexed to Human Chemokine CCL17
8FJ3 2.07 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL7(Y13A)
8SKK 2.1 Å, Crystal Structure of the Tick Evasin EVA-AAM1001(L39P) Complexed to Human Chemokine CCL17

Browse structure collections

About this viewer

MolViewer shows 8FJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.