8FM6: Ssr1698 protein

Dri1 hemoprotein variant H21A with a zinc-mirror heme site. Determined by X-ray diffraction at 2.85 Å resolution. Released 24 Apr 2024.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Synechocystis sp. PCC 6803
Chains: 2
Atoms: 1,523
Mol. weight: 23.1 kDa
Ligands: HEB
Released: 24 Apr 2024

Explore 8FM6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FM6 contains 6 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	22-31	10
β-strand	40-47	8	1
β-strand	50-56	7	1
β-strand	62-67	6	1
α-helix	75-94	20

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	22-31	10
β-strand	38-47	10	2
β-strand	50-57	8	2
β-strand	60-67	8	2
α-helix	75-94	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ssr1698 protein	A, B	protein	103	Synechocystis sp. PCC 6803	P73129 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8FM6_1 Ssr1698 protein (chains A, B)
MADPLTPAISDRICKHMNEDAASAIALYAQVFGQQTDVTMAQMQAIDPTGMDLVVESEGG
SKTIRIEFEQPLKDSEDAHQVLIAMAKQARSVGKNSAENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
HEB	Heme b/c	C34 H34 Fe N4 O4	1

Primary citation

A hemoprotein with a zinc-mirror heme site ties heme availability to carbon metabolism in cyanobacteria. Grosjean, N., Yee, E.F., Kumaran, D. et al. Nat Commun (2024) 15:3167-3167. DOI 10.1038/s41467-024-47486-z · PubMed

Other PDB entries of the same protein (UniProt P73129 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZXQ 1.51 Å, Crystal structure of Ssr1698 in complex with heme b
8ZXR 1.6 Å, Crystal structure of Ssr1698 in complex with heme c
8GDW 2.35 Å, Crystal structure of Domain Related to Iron (DRI) from cyanobacteria
8GBK 2.9 Å, Dri1 hemoprotein variant H79A-R90A with a zinc-mirror heme site
8GF4 3.0 Å, Crystal structure of Domain Related to Iron (DRI) in complex with heme

Browse structure collections

About this viewer

MolViewer shows 8FM6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.