Crystal structure of human proTGF-beta2 in complex with Nb18. Determined by X-ray diffraction at 2.2 Å resolution. Released 21 Jun 2023.
Explore 8FXV in 3D Show helices and sheets RCSB PDB PDBe
8FXV contains 16 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-47 | 17 | |
| α-helix | 65-81 | 17 | |
| β-strand | 102-107 | 6 | 1 |
| α-helix | 108-110 | 3 | |
| β-strand | 117 | 1 | 2 |
| α-helix | 118-119 | 2 | |
| β-strand | 121-124 | 4 | 3 |
| β-strand | 127-130 | 4 | 3 |
| α-helix | 135-143 | 9 | |
| β-strand | 144-154 | 11 | 1 |
| α-helix | 155 | 1 | |
| β-strand | 163-171 | 9 | 3 |
| β-strand | 182-191 | 10 | 3 |
| α-helix | 195-196 | 2 | |
| β-strand | 197-202 | 6 | 1 |
| α-helix | 204-212 | 9 | |
| α-helix | 214-216 | 3 | |
| β-strand | 220-224 | 5 | 3 |
| β-strand | 249-250 | 2 | 1 |
| β-strand | 280-285 | 6 | 1 |
| α-helix | 288-291 | 4 | |
| β-strand | 304-305 | 2 | 4 |
| α-helix | 306-309 | 4 | |
| β-strand | 316 | 1 | 5 |
| β-strand | 318-320 | 3 | 6 |
| β-strand | 324-325 | 2 | 7 |
| α-helix | 326-330 | 5 | |
| β-strand | 335-337 | 3 | 8 |
| β-strand | 340-341 | 2 | 7 |
| β-strand | 345-347 | 3 | 6 |
| β-strand | 349 | 1 | 5 |
| α-helix | 366-369 | 4 | |
| β-strand | 380-382 | 3 | 4 |
| β-strand | 385-393 | 9 | 8 |
| β-strand | 398-408 | 11 | 8 |
| β-strand | 410-413 | 4 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 9 |
| β-strand | 10-12 | 3 | 3 |
| β-strand | 18-24 | 7 | 9 |
| β-strand | 34-39 | 6 | 3 |
| α-helix | 44-45 | 2 | |
| β-strand | 46-51 | 6 | 3 |
| β-strand | 57-59 | 3 | 3 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 9 |
| β-strand | 77-82 | 6 | 9 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-98 | 8 | 3 |
| β-strand | 104 | 1 | 2 |
| β-strand | 105-108 | 4 | 3 |
| β-strand | 112-116 | 5 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transforming growth factor beta-2 proprotein | A | protein | 393 | Homo sapiens | P61812 (AlphaFold model) |
| Nanobody clone 18 | B | protein | 124 | synthetic construct |
>8FXV_1 Transforming growth factor beta-2 proprotein (chains A) GPSLSTSSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISIYNSTRDL LQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFDVSAM EKRASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGE WLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTS TYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNGALDAAYCFRNVQDNCCLRP LYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCV SQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
>8FXV_2 Nanobody clone 18 (chains B) QVQLQESGGGLVQAGGSLRLSCAASGYISNDDVMGWYRQAPGKEREFVAAISVGASTNYA DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAQSEGGYWFGYWGQGTQVTVSSHH HHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
A specialized integrin-binding motif enables proTGF-beta 2 activation by integrin alpha V beta 6 but not alpha V beta 8. Le, V.Q., Zhao, B., Ramesh, S. et al. Proc Natl Acad Sci U S A (2023) 120:e2304874120-e2304874120. DOI 10.1073/pnas.2304874120 · PubMed
Other PDB entries of the same protein (UniProt P61812 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8FXV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.