8FXX: Cowpox virus M2

Cryo-EM structure of cowpox virus M2 in complex with human B7.2 (heptameric ring). Determined by electron microscopy at 3.26 Å resolution. Released 5 Feb 2025.

Method: Electron microscopy
Resolution: 3.26 Å
Organisms: Cowpox virus (Brighton Red), Homo sapiens
Chains: 14
Atoms: 17,556
Mol. weight: 258.37 kDa
Ligands: NAG
Released: 5 Feb 2025

Explore 8FXX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FXX contains 28 α-helices and 170 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, D, K and M: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	1
β-strand	18-22	5	2
β-strand	36-40	5	3
β-strand	46-51	6	3
β-strand	55-61	7	3
β-strand	68-75	8	2
β-strand	80-87	8	2
β-strand	98-104	7	3
β-strand	112-114	3	3
β-strand	117-118	2	3
β-strand	128-133	6	3
β-strand	139-144	6	2
β-strand	160-161	2	1
α-helix	167-169	3
β-strand	171-176	6	2
β-strand	194-195	2	2

Chain B: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	4
β-strand	18-22	5	5
β-strand	36-40	5	6
β-strand	46-51	6	6
β-strand	55-62	8	6
β-strand	68-75	8	5
β-strand	80-87	8	5
β-strand	97-104	8	6
β-strand	112-114	3	6
β-strand	117-118	2	6
β-strand	128-133	6	6
β-strand	139-144	6	5
β-strand	160-161	2	4
α-helix	167-169	3
β-strand	171-176	6	5
β-strand	194-195	2	5

Chains C, E, G and L: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1-4	4	5
β-strand	11-14	4	7
α-helix	25-27	3
β-strand	28-34	7	5
β-strand	39-44	6	5
β-strand	47-49	3	5
α-helix	55-57	3
β-strand	61-63	3	7
β-strand	69-72	4	7
α-helix	77-79	3
β-strand	81-90	10	5
β-strand	95-106	12	5

Chain F: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	12
β-strand	17-22	6	13
β-strand	36-40	5	14
β-strand	46-51	6	14
β-strand	55-61	7	14
β-strand	68-75	8	13
β-strand	80-87	8	13
β-strand	98-104	7	14
β-strand	112-114	3	14
β-strand	117-118	2	14
β-strand	128-133	6	14
β-strand	139-144	6	13
β-strand	160	1	12
α-helix	167-169	3
β-strand	171-176	6	13
β-strand	194-195	2	13

Chains H and N: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	1-4	4	2
β-strand	11-14	4	16
α-helix	25-27	3
β-strand	28-34	7	2
β-strand	39-44	6	2
β-strand	47-49	3	2
α-helix	55-57	3
β-strand	61-63	3	16
β-strand	69-72	4	16
α-helix	77-79	3
β-strand	81-90	10	2
β-strand	95-99	5	2
β-strand	102-106	5	2

Chain I: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	17
β-strand	18-22	5	18
β-strand	36-40	5	19
β-strand	46-51	6	19
β-strand	55-61	7	19
β-strand	68-75	8	18
β-strand	80-87	8	18
β-strand	98-104	7	19
β-strand	112-114	3	19
β-strand	117-118	2	19
β-strand	128-133	6	19
β-strand	139-144	6	18
β-strand	160	1	17
α-helix	167-169	3
β-strand	171-176	6	18
β-strand	194-195	2	18

Chain J: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1-4	4	18
β-strand	11-14	4	20
α-helix	25-27	3
β-strand	28-33	6	18
β-strand	39-44	6	18
β-strand	47-49	3	18
α-helix	55-57	3
β-strand	61-63	3	20
β-strand	69-72	4	20
α-helix	77-79	3
β-strand	81-90	10	18
β-strand	95-106	12	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CPXV040 protein	A, B, D, F, I, K, M	protein	204	Cowpox virus (Brighton Red)	Q8QN22 (AlphaFold model)
T-lymphocyte activation antigen CD86	C, E, G, H, J, L, N	protein	110	Homo sapiens	P42081 (AlphaFold model)

Sequence of entity 1 (A, B, D, F, I, K, M), FASTA

>8FXX_1 CPXV040 protein (chains A, B, D, F, I, K, M)
KPEAEYKNTICPPRQDYRYWYFAAELTIGVNYDINSTIMGECHMSESYIDRNANIVLTGY
GLEINMTIMDTDQRFVAAAEGVGKDNKLSVLLFTTQRLDKVHHNISVTITCMEMNCGTTK
YDSDLPESIHHKSSCDITINGSCVTCVNLETDPTKINPHYLHPKDKYLYRNSEYGMRGSY
GVTFMDELNQCFLDIKEVSYDICY

Sequence of entity 2 (C, E, G, H, J, L, N), FASTA

>8FXX_2 T-lymphocyte activation antigen CD86 (chains C, E, G, H, J, L, N)
MLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMG
RTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	21

Primary citation

Structure basis of poxvirus mediated sabotage of T-cell costimulation. Elliott, J.I., Adams, L.J., Jethva, P.N. et al. To be published.

Other PDB entries of the same protein (UniProt Q8QN22 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FXW 2.7 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (hexameric ring)
8FXZ 2.86 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (heptameric ring)
8FXY 3.34 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.2 (hexameric ring)

Browse structure collections

About this viewer

MolViewer shows 8FXX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.