8FZM: Human importin alpha 3

Human importin alpha 3 in complex with Bimax2 peptide. Determined by X-ray diffraction at 3.0 Å resolution. Released 8 Feb 2023.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 6,236
Mol. weight: 107.98 kDa
Released: 8 Feb 2023

Explore 8FZM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FZM contains 66 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	73-80	8
α-helix	85-99	15
α-helix	107-112	6
α-helix	115-122	8
α-helix	129-142	14
α-helix	147-155	9
α-helix	158-165	8
α-helix	171-186	16
α-helix	189-197	9
α-helix	201-205	5
α-helix	214-228	15
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-270	15
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-323	8
α-helix	327-330	4
α-helix	332-335	4
α-helix	340-354	15
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-397	16
α-helix	401-409	9
α-helix	413-417	5
α-helix	418-421	4
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-465	8
α-helix	471-482	12

Chains B and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	17-19	3

Chain C: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	73-80	8
α-helix	85-99	15
α-helix	107-112	6
α-helix	115-122	8
α-helix	129-143	15
α-helix	147-155	9
α-helix	158-165	8
α-helix	171-186	16
α-helix	189-197	9
α-helix	201-205	5
α-helix	214-228	15
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-269	14
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-323	8
α-helix	327-330	4
α-helix	332-335	4
α-helix	340-353	14
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-397	16
α-helix	401-409	9
α-helix	413-417	5
α-helix	418-421	4
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-465	8
α-helix	471-482	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A, C	protein	459	Homo sapiens	O00629 (AlphaFold model)
Bimax2	B, D	protein	27	synthetic construct

Sequence of entity 1 (A, C), FASTA

>8FZM_1 Importin subunit alpha-3 (chains A, C)
SGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHC
LERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALG
NIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQE
ILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQT
AALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQ
AVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTV
KDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIID
QFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

Sequence of entity 2 (B, D), FASTA

>8FZM_2 Bimax2 (chains B, D)
SRRRRRRKRKREWDDDDDPPKKRRRLD

Primary citation

Human importin alpha 3 in complex with Bimax2 peptide. Donnelly, C.M., Forwood, J.K. To be published.

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain

Browse structure collections

About this viewer

MolViewer shows 8FZM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.