8FZU: PDB entry 8FZU

The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag. Determined by X-ray diffraction at 1.9 Å resolution. Released 19 Jul 2023.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 3
Atoms: 6,714
Mol. weight: 86.25 kDa
Released: 19 Jul 2023

Explore 8FZU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FZU contains 47 α-helices and 18 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	13-15	3
α-helix	18-31	14
α-helix	34-36	3
α-helix	46-51	6
α-helix	54-60	7
α-helix	65-77	13
β-strand	83-90	8	1
α-helix	93-95	3
α-helix	99-113	15
β-strand	118-125	8	1
β-strand	129-136	8	1
α-helix	139-150	12
α-helix	160-173	14
β-strand	180-187	8	1
α-helix	195-208	14
β-strand	212-217	6	1
α-helix	223-229	7
α-helix	233-235	3
β-strand	236-238	3	1
α-helix	242-253	12

Chain B: 15 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-15	3
α-helix	18-32	15
α-helix	34-36	3
α-helix	46-51	6
α-helix	54-60	7
α-helix	65-78	14
β-strand	83-90	8	2
α-helix	93-95	3
α-helix	99-112	14
β-strand	118-125	8	2
β-strand	129-136	8	2
α-helix	139-150	12
α-helix	160-173	14
β-strand	180-187	8	2
α-helix	195-208	14
β-strand	212-217	6	2
α-helix	223-229	7
α-helix	233-235	3
β-strand	236-238	3	2
α-helix	239-254	16

Chain C: 17 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
α-helix	8-10	3
α-helix	13-15	3
α-helix	18-32	15
α-helix	34-38	5
α-helix	46-51	6
α-helix	54-60	7
α-helix	65-78	14
β-strand	83-90	8	3
α-helix	93-95	3
α-helix	99-113	15
β-strand	118-125	8	3
β-strand	129-136	8	3
α-helix	139-150	12
α-helix	160-174	15
α-helix	179	1
β-strand	180-187	8	3
α-helix	195-208	14
β-strand	212-217	6	3
α-helix	223-229	7
α-helix	233-235	3
β-strand	236-238	3	3
α-helix	242-254	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,Anthrax toxin receptor 2	A, B, C	protein	257	Homo sapiens	P41212 (AlphaFold model), P58335 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8FZU_1 Transcription factor ETV6,Anthrax toxin receptor 2 (chains A, B, C)
GSIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYR
SPHSGDELYELLQHILAQARTVFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRL
SFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTS
SIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLERIADSKEQVFPVK
GGFQALKGIINSILAQS

Primary citation

Increasing the bulk of the 1TEL-target linker and retaining the 10×His tag in a 1TEL-CMG2-vWa construct improves crystal order and diffraction limits. Gajjar, P.L., Pedroza Romo, M.J., Litchfield, C.M. et al. Acta Crystallogr D Struct Biol (2023) 79:925-943. DOI 10.1107/S2059798323007246 · PubMed

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 8FZU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.