8GT1: Human cardiac alpha actin A108G mutant

Crystal structure of human cardiac alpha actin A108G mutant (ADP-Pi state) in complex with fragmin F1 domain. Determined by X-ray diffraction at 1.35 Å resolution. Released 8 Mar 2023.

Method: X-ray diffraction
Resolution: 1.35 Å
Organisms: Homo sapiens, Physarum polycephalum
Chains: 2
Atoms: 5,141
Mol. weight: 63.39 kDa
Ligands: ADP, ATP, PO4, MG
Released: 8 Mar 2023

Explore 8GT1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GT1 contains 36 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	8-12	5	1
β-strand	16-21	6	1
β-strand	24	1	2
β-strand	29-32	4	1
β-strand	35-38	4	3
β-strand	53-54	2	3
α-helix	56-60	5
β-strand	65-68	4	3
β-strand	71-72	2	4
β-strand	75-76	2	4
α-helix	79-87	9
α-helix	88-94	7
α-helix	98-100	3
β-strand	103-107	5	1
β-strand	112	1	5
α-helix	113-125	13
β-strand	131-136	6	1
α-helix	137-144	8
β-strand	150-155	6	6
β-strand	160-166	7	6
β-strand	169-170	2	6
α-helix	172-174	3
β-strand	176-178	3	6
α-helix	182-193	12
α-helix	194-196	3
α-helix	203-216	14
α-helix	223-232	10
β-strand	238-241	4	7
β-strand	247-250	4	7
α-helix	253-262	10
α-helix	264-267	4
α-helix	271-273	3
α-helix	274-283	10
α-helix	287-294	8
β-strand	297-300	4	6
α-helix	302-305	4
α-helix	309-320	12
β-strand	329-330	2	6
α-helix	335-337	3
α-helix	338-346	9
α-helix	350-354	5
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	367-369	3
α-helix	370-373	4

Chain B: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12	1	5
α-helix	20-30	11
α-helix	34-36	3
β-strand	44-51	8	8
β-strand	54-57	4	8
α-helix	58-59	2
α-helix	60-62	3
β-strand	65-67	3	9
β-strand	71-78	8	8
β-strand	88-95	8	8
α-helix	101-117	17
α-helix	122	1
β-strand	123-128	6	8
α-helix	134-137	4
β-strand	146-148	3	9
α-helix	152-154	3
α-helix	156	1
β-strand	157	1	2
α-helix	158-159	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, alpha cardiac muscle 1	A	protein	391	Homo sapiens	P68032 (AlphaFold model)
Actin-binding protein fragmin P	B	protein	162	Physarum polycephalum	Q94707 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8GT1_1 Actin, alpha cardiac muscle 1 (chains A)
MGWSHPQFEKGGIEGRDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVM
VGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTL
LTEGPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVP
IYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFE
NEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMK
CDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGS
ILASLSTFQQMWISKQEYDEAGPSIVHRKCF

Sequence of entity 2 (B), FASTA

>8GT1_2 Actin-binding protein fragmin P (chains B)
GPMQKQKEYNIADSNIANLGTELEKKVKLEASQHEDAWKGAGKQVGVEIWRIQQFKVVPV
PKKHHGSFYTGDSYIVLSTYHPKTNPDKLAYDVHFWLGAFTTQDEAGTAAYKTVELDDYL
GGLPVQYREVQGYESERFLSLFPKGGLRILDGGVETGFHHVE

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
PO4	Phosphate ion	O4 P	3
MG	Magnesium ion	Mg	1
CA	Calcium ion	Ca	2

Water and common crystallization additives (EDO) are not listed.

Primary citation

Mutagenic analysis of actin reveals the mechanism of His161 flipping that triggers ATP hydrolysis. Iwasa, M., Takeda, S., Narita, A. et al. Front Cell Dev Biol (2023) 11:1105460-1105460. DOI 10.3389/fcell.2023.1105460 · PubMed

Other PDB entries of the same protein (UniProt P68032 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GSW 1.4 Å, Crystal structure of human cardiac alpha actin A108G mutant (AMPPNP state) in complex…
8GT5 1.4 Å, Crystal structure of human cardiac alpha actin Q137A mutant (ADP-Pi state) in complex…
8GSU 1.5 Å, Crystal structure of human cardiac alpha actin (WT_ADP-Pi) in complex with fragmin F1…
8GT2 1.5 Å, Crystal structure of human cardiac alpha actin P109A mutant (AMPPNP state) in complex…
8GT3 1.5 Å, Crystal structure of human cardiac alpha actin P109A mutant (ADP-Pi state) in complex…
8GT4 1.55 Å, Crystal structure of human cardiac alpha actin Q137A mutant (AMPPNP state) in complex…
9ZBL 2.79 Å, Helical Reconstruction of the Human Cardiac F-Actin-Tropomyosin Complex
8ZI9 3.08 Å, Human left ventricle actin and myosin complex
9BPH 3.12 Å, cryo-EM structure of cardiac muscle alpha-actin M305L hcm mutant
9ZBP 3.12 Å, Helical Reconstruction of the Complex of Pseudo-Acetylated Human Cardiac Actin…
8ZB7 3.19 Å, Human left ventricle ATM complex
9B3R 3.5 Å, The structure of human cardiac F-actin

Browse structure collections

About this viewer

MolViewer shows 8GT1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.