Crystal structure of EP300 HAT domain in complex with compound 10. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Jan 2023.
Explore 8GZC in 3D Show helices and sheets RCSB PDB PDBe
8GZC contains 59 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1169 | 1 | 1 |
| α-helix | 1170-1174 | 5 | |
| β-strand | 1175-1176 | 2 | 2 |
| β-strand | 1184-1185 | 2 | 2 |
| β-strand | 1190-1194 | 5 | 3 |
| β-strand | 1198-1201 | 4 | 3 |
| α-helix | 1202-1206 | 5 | |
| β-strand | 1213-1215 | 3 | 4 |
| β-strand | 1224-1226 | 3 | 4 |
| α-helix | 1228-1230 | 3 | |
| β-strand | 1232-1235 | 4 | 3 |
| α-helix | 1240 | 1 | |
| β-strand | 1241 | 1 | 1 |
| α-helix | 1242-1243 | 2 | |
| β-strand | 1244-1246 | 3 | 5 |
| β-strand | 1253-1255 | 3 | 5 |
| α-helix | 1256-1259 | 4 | |
| α-helix | 1273-1278 | 6 | |
| α-helix | 1283-1285 | 3 | |
| α-helix | 1294-1295 | 2 | |
| α-helix | 1297-1313 | 17 | |
| β-strand | 1321-1334 | 14 | 6 |
| α-helix | 1335-1336 | 2 | |
| α-helix | 1337-1339 | 3 | |
| α-helix | 1340-1344 | 5 | |
| β-strand | 1352-1366 | 15 | 6 |
| β-strand | 1369-1381 | 13 | 6 |
| α-helix | 1386 | 1 | |
| β-strand | 1392-1400 | 9 | 6 |
| α-helix | 1407-1409 | 3 | |
| α-helix | 1410-1428 | 19 | |
| β-strand | 1432-1436 | 5 | 6 |
| α-helix | 1439-1441 | 3 | |
| α-helix | 1456-1459 | 4 | |
| α-helix | 1460-1476 | 17 | |
| β-strand | 1482-1485 | 4 | 6 |
| α-helix | 1486-1493 | 8 | |
| α-helix | 1498-1500 | 3 | |
| α-helix | 1508-1519 | 12 | |
| α-helix | 1584-1591 | 8 | |
| α-helix | 1592-1594 | 3 | |
| β-strand | 1595-1599 | 5 | 6 |
| α-helix | 1603-1606 | 4 | |
| α-helix | 1609-1612 | 4 | |
| β-strand | 1619 | 1 | 6 |
| α-helix | 1622-1624 | 3 | |
| α-helix | 1628-1636 | 9 | |
| α-helix | 1644-1663 | 20 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1169 | 1 | 7 |
| α-helix | 1170-1174 | 5 | |
| β-strand | 1175-1176 | 2 | 8 |
| β-strand | 1184-1185 | 2 | 8 |
| β-strand | 1190-1194 | 5 | 9 |
| β-strand | 1198-1201 | 4 | 9 |
| α-helix | 1202-1206 | 5 | |
| β-strand | 1213-1214 | 2 | 10 |
| β-strand | 1225-1226 | 2 | 10 |
| α-helix | 1228-1230 | 3 | |
| β-strand | 1232-1235 | 4 | 9 |
| α-helix | 1240 | 1 | |
| β-strand | 1241 | 1 | 7 |
| α-helix | 1242-1243 | 2 | |
| β-strand | 1244-1246 | 3 | 11 |
| β-strand | 1253-1255 | 3 | 11 |
| α-helix | 1256-1259 | 4 | |
| α-helix | 1273-1277 | 5 | |
| α-helix | 1283-1285 | 3 | |
| α-helix | 1294-1295 | 2 | |
| α-helix | 1297-1313 | 17 | |
| β-strand | 1321-1334 | 14 | 12 |
| α-helix | 1335-1336 | 2 | |
| α-helix | 1337-1339 | 3 | |
| α-helix | 1340-1344 | 5 | |
| β-strand | 1352-1365 | 14 | 12 |
| β-strand | 1370-1381 | 12 | 12 |
| α-helix | 1386 | 1 | |
| β-strand | 1392-1400 | 9 | 12 |
| α-helix | 1407-1409 | 3 | |
| α-helix | 1410-1428 | 19 | |
| β-strand | 1432-1436 | 5 | 12 |
| α-helix | 1439-1441 | 3 | |
| α-helix | 1456-1459 | 4 | |
| α-helix | 1460-1476 | 17 | |
| β-strand | 1482-1485 | 4 | 12 |
| α-helix | 1486-1492 | 7 | |
| α-helix | 1498-1500 | 3 | |
| α-helix | 1508-1519 | 12 | |
| α-helix | 1584-1590 | 7 | |
| α-helix | 1592-1594 | 3 | |
| β-strand | 1595-1599 | 5 | 12 |
| α-helix | 1603-1607 | 5 | |
| α-helix | 1610-1612 | 3 | |
| α-helix | 1617-1618 | 2 | |
| β-strand | 1619 | 1 | 12 |
| α-helix | 1622-1624 | 3 | |
| α-helix | 1628-1636 | 9 | |
| α-helix | 1644-1659 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone acetyltransferase p300 | A, B | protein | 454 | Homo sapiens | Q09472 (AlphaFold model) |
>8GZC_1 Histone acetyltransferase p300 (chains A, B) GPSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLG DDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCL KKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVK PGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYIS YLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQK IPKPKRLQEWFKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEES IKESGGSGSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLT LARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRF
| ID | Name | Formula | Copies |
|---|---|---|---|
| KQO | (2~{R},4~{R})-4-fluoranyl-1-[1-(4-methoxyphenyl)cyclohexyl]carbonyl-~{N}-(1~{H}… | C25 H28 F N5 O3 | 2 |
| ZN | Zinc ion | Zn | 6 |
Discovery of DS-9300: A Highly Potent, Selective, and Once-Daily Oral EP300/CBP Histone Acetyltransferase Inhibitor. Kanada, R., Kagoshima, Y., Suzuki, T. et al. J Med Chem (2023) 66:695-715. DOI 10.1021/acs.jmedchem.2c01641 · PubMed
Other PDB entries of the same protein (UniProt Q09472 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8GZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.