8H43: PHF1 Tudor domain

Crystal structure of PHF1 Tudor domain in complex with hit 1. Determined by X-ray diffraction at 2.3 Å resolution. Released 18 Oct 2023.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,393
Mol. weight: 21.65 kDa
Ligands: 1HI
Released: 18 Oct 2023

Explore 8H43 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8H43 contains 3 α-helices and 15 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	36-40	5	1
β-strand	46-55	10	1
β-strand	60-65	6	1
β-strand	70-74	5	1
α-helix	75-77	3
β-strand	78-80	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 1	A, B, C	protein	61	Homo sapiens	O43189 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8H43_1 PHD finger protein 1 (chains A, B, C)
MRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGE
E

Ligands and cofactors

ID	Name	Formula	Copies
1HI	2-[(3S)-piperidin-3-yl]-1,3-benzoxazole	C12 H14 N2 O	3

Primary citation

Crystal structure of PHF1 Tudor domain in complex with hit 1. Liu, Y., Ruan, K. To be published.

Other PDB entries of the same protein (UniProt O43189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WAV 1.7 Å, Crystal structure of PHF1 in complex with H3K36me3 substitution
6WAT 1.8 Å, complex structure of PHF1
4HCZ 1.85 Å, PHF1 Tudor in complex with H3K36me3
7LKY 1.85 Å, Crystal Structure of PHF1 Tudor domain in complex with a peptidomimetic ligand UNC6641
5XFN 1.9 Å, Structure of the N-terminal domains of PHF1
5XFO 1.9 Å, Structure of the N-terminal domains of PHF1
5XFP 2.3 Å, Binary complex of PHF1 and a double stranded DNA
2E5P Solution structure of the TUDOR domain of PHD finger protein 1 (PHF1 protein)
2M0O The solution structure of human PHF1 in complex with H3K36me3

Browse structure collections

About this viewer

MolViewer shows 8H43 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.