8HEO: SIAH1 SBD

Crystal structure of SIAH1 SBD bound to Axin2 peptide. Determined by X-ray diffraction at 2.53 Å resolution. Released 15 Nov 2023.

Method: X-ray diffraction
Resolution: 2.53 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,049
Mol. weight: 46.25 kDa
Ligands: ZN
Released: 15 Nov 2023

Explore 8HEO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HEO contains 18 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	95-97	3	1
α-helix	99-103	5
β-strand	108-110	3	1
α-helix	114-120	7
α-helix	125	1
β-strand	126-127	2	2
α-helix	128	1
β-strand	138-139	2	2
α-helix	141-151	11
β-strand	156-158	3	3
β-strand	162-167	6	4
β-strand	177-184	8	3
β-strand	187-197	11	3
β-strand	203-211	9	3
α-helix	215-218	4
β-strand	221-229	9	4
β-strand	232-238	7	4
α-helix	239-240	2
β-strand	241-242	2	3
α-helix	248-252	5
β-strand	257-260	4	3
α-helix	261-267	7
β-strand	269	1	5
β-strand	272	1	5
β-strand	273-281	9	4

Chain B: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	95-97	3	6
α-helix	101-103	3
β-strand	108-110	3	6
α-helix	114-120	7
α-helix	125-128	4
β-strand	133	1	7
β-strand	135	1	7
α-helix	141-143	3
α-helix	144-147	4
β-strand	157-159	3	8
β-strand	162-168	7	9
β-strand	177-184	8	8
β-strand	187-199	13	8
β-strand	202-211	10	8
α-helix	215-218	4
β-strand	221-228	8	9
β-strand	233-238	6	9
α-helix	239-240	2
β-strand	241-242	2	8
α-helix	248-252	5
β-strand	257-260	4	8
α-helix	261-267	7
β-strand	269	1	9
β-strand	272-281	10	9

Chain G: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	364-365	2	9
β-strand	367	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SIAH1	A, B	protein	194	Homo sapiens	Q8IUQ4 (AlphaFold model)
Peptide from Axin-2	G	protein	21	Homo sapiens	Q9Y2T1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8HEO_1 E3 ubiquitin-protein ligase SIAH1 (chains A, B)
KVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHL
MHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAI
VQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFA
ENGNLGINVTISMC

Sequence of entity 2 (G), FASTA

>8HEO_2 Peptide from Axin-2 (chains G)
HRLPKEMTPVEPATFAAELIS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Crystal structure of SIAH1 SBD bound to Axin2 peptide. Yan, X.X., Tian, L.F. To be published.

Other PDB entries of the same protein (UniProt Q8IUQ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CA1 1.58 Å, Crystal structure of Siah1 at 1.58 A resolution.
9G0L 1.9 Å, Crystal structure of the RING-ZnF1 fragment of SIAH1
4C9Z 1.95 Å, Crystal structure of Siah1 at 1.95 A resolution
5WZZ 2.1 Å, The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating…
2A25 2.2 Å, Crystal structure of Siah1 SBD bound to the peptide EKPAAVVAPITTG from SIP
4X3G 2.34 Å, Crystal structure of SIAH1 SINA domain in complex with a USP19 peptide
4I7D 2.4 Å, Siah1 bound to synthetic peptide (ACE)KLRPVAMVRP(PRK)VR
4I7C 2.8 Å, Siah1 mutant bound to synthetic peptide (ACE)KLRPV(23P)MVRPWVR
4I7B 3.0 Å, Siah1 bound to synthetic peptide (ACE)KLRPV(ABA)MVRPTVR

Browse structure collections

About this viewer

MolViewer shows 8HEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.