Toxascaris leonina galectin (Tl-gal) and Human T-cell immunoglobulin mucin-3 (Tim3) complex. Determined by electron microscopy at 4.82 Å resolution. Released 22 Nov 2023.
Explore 8HGJ in 3D Show helices and sheets RCSB PDB PDBe
8HGJ contains 2 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-25 | 3 | 1 |
| β-strand | 26-30 | 5 | 2 |
| β-strand | 40-42 | 3 | 3 |
| β-strand | 44 | 1 | 4 |
| β-strand | 53 | 1 | 5 |
| β-strand | 56-58 | 3 | 3 |
| β-strand | 60 | 1 | 6 |
| β-strand | 67 | 1 | 6 |
| β-strand | 70 | 1 | 3 |
| β-strand | 72 | 1 | 7 |
| β-strand | 73 | 1 | 5 |
| β-strand | 77 | 1 | 7 |
| α-helix | 87-88 | 2 | |
| β-strand | 89 | 1 | 8 |
| β-strand | 91 | 1 | 8 |
| β-strand | 92-96 | 5 | 2 |
| β-strand | 99 | 1 | 9 |
| β-strand | 104-108 | 5 | 9 |
| β-strand | 111-116 | 6 | 9 |
| β-strand | 125 | 1 | 4 |
| β-strand | 141-143 | 3 | 1 |
| β-strand | 164-167 | 4 | 10 |
| β-strand | 182 | 1 | 11 |
| β-strand | 183 | 1 | 12 |
| β-strand | 191 | 1 | 11 |
| β-strand | 194-196 | 3 | 13 |
| β-strand | 201-203 | 3 | 13 |
| β-strand | 204 | 1 | 14 |
| β-strand | 207-208 | 2 | 15 |
| β-strand | 211-212 | 2 | 15 |
| β-strand | 216 | 1 | 14 |
| β-strand | 231-234 | 4 | 10 |
| β-strand | 241-244 | 4 | 10 |
| β-strand | 247-251 | 5 | 10 |
| β-strand | 263 | 1 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 16 |
| α-helix | 66-68 | 3 | |
| β-strand | 70 | 1 | 16 |
| β-strand | 84-90 | 7 | 17 |
| β-strand | 99-105 | 7 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Galectin | A | protein | 278 | Toxascaris leonina | A0A1L1QJZ7 (AlphaFold model) |
| Hepatitis A virus cellular receptor 2 | B | protein | 107 | Homo sapiens | Q8TDQ0 (AlphaFold model) |
>8HGJ_1 Galectin (chains A) MATETNYPVPYRSKLTEPFEPGQTLIIKGKTAEDSVRFTINLHNTSADFSGNDVPLHISV RFDEGKIVFNTFSKGEWGKEERKSNPYKKGDDIDIRIRAHDSKFSISVDQKEVKEYEHRV PLSSVTHFSVDGDILITYIHWGGKYYPVPYESGLAGDGLAPGKSLLIFATPEKKGKRFHI NLLKKNGDIALHFNPRFDEKAIVRNSLISGEWGNEEREGKNPLEKGIGCDLEFRNEEYAF QIYVDGERFATYAHRLDPHDINGLQIGGDVEVTGIQMV
>8HGJ_2 Hepatitis A virus cellular receptor 2 (chains B) VEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYW LNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIK
Toxascaris leonina galectin (Tl-gal) and Human T-cell immunoglobulin mucin-3 (Tim3) complex. Han, C.W., Jang, S.B. To be published.
Other PDB entries of the same protein (UniProt A0A1L1QJZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8HGJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.