8HKW: Importin-alpha3

Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Dec 2022.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,270
Mol. weight: 96.54 kDa
Released: 21 Dec 2022

Explore 8HKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HKW contains 72 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	72-79	8
α-helix	85-100	16
α-helix	107-113	7
α-helix	116-122	7
α-helix	129-142	14
α-helix	147-155	9
α-helix	158-165	8
α-helix	171-185	15
α-helix	189-197	9
α-helix	201-205	5
α-helix	214-228	15
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-270	15
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-323	8
α-helix	327-330	4
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-398	17
α-helix	401-409	9
α-helix	413-417	5
α-helix	418-421	4
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-464	7
α-helix	465-467	3
α-helix	471-484	14

Chain B: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	72-79	8
α-helix	85-100	16
α-helix	107-112	6
α-helix	116-122	7
α-helix	129-143	15
α-helix	147-155	9
α-helix	159-165	7
α-helix	171-185	15
α-helix	189-197	9
α-helix	201-205	5
α-helix	214-228	15
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-270	15
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-323	8
α-helix	327-330	4
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-398	17
α-helix	401-409	9
α-helix	413-417	5
α-helix	418-421	4
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-464	7
α-helix	465-467	3
α-helix	471-484	14

Chains C and D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	1669-1672	4
α-helix	1673-1677	5
α-helix	1683-1685	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A, B	protein	416	Homo sapiens	O00629 (AlphaFold model)
Peptide from TP53-binding protein 1	C, D	protein	22	Homo sapiens	Q12888 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8HKW_1 Importin subunit alpha-3 (chains A, B)
NTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNP
SLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGP
QCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCV
LIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVG
NIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANL
VPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQ
VVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFF

Sequence of entity 2 (C, D), FASTA

>8HKW_2 Peptide from TP53-binding protein 1 (chains C, D)
SGKRKLITSEEERSPAKRGRKS

Primary citation

Crystallographic data of an importin-alpha 3 dimer in which the two protomers are bridged by a bipartite nuclear localization signal. Matsuura, Y. Data Brief (2023) 47:108988-108988. DOI 10.1016/j.dib.2023.108988 · PubMed

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain
8FUB 2.75 Å, Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein…

Browse structure collections

About this viewer

MolViewer shows 8HKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.