8HU7: FGF2-M1 mutant - D28E/C78L/C96I/S137P

Crystal structure of FGF2-M1 mutant - D28E/C78L/C96I/S137P. Determined by X-ray diffraction at 1.4 Å resolution. Released 26 Jun 2024.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,223
Mol. weight: 16.61 kDa
Released: 26 Jun 2024

Explore 8HU7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HU7 contains 5 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	30-34	5	1
β-strand	39-43	5	1
β-strand	49-52	4	1
α-helix	58-60	3
β-strand	62-68	7	1
β-strand	71-76	6	1
β-strand	81-85	5	1
β-strand	91-94	4	1
α-helix	99-101	3
β-strand	103-107	5	1
β-strand	113-117	5	1
β-strand	124	1	1
β-strand	127	1	2
β-strand	132	1	1
β-strand	133	1	2
α-helix	134-135	2
α-helix	136-138	3
α-helix	144-146	3
β-strand	148-152	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibroblast growth factor 2	A	protein	147	Homo sapiens	P09038 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8HU7_1 Fibroblast growth factor 2 (chains A)
MPALPEDGGSGAFPPGHFKEPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEE
RGVVSIKGVLANRYLAMKEDGRLLASKIVTDECFFFERLESNNYNTYRSRKYTSWYVALK
RTGQYKLGPKTGPGQKAILFLPMSAKS

Primary citation

Structural and biochemical investigation into stable FGF2 mutants with novel mutation sites and hydrophobic replacements for surface-exposed cysteines. An, Y.J., Jung, Y.E., Lee, K.W. et al. PLoS One (2024) 19:e0307499-e0307499. DOI 10.1371/journal.pone.0307499 · PubMed

Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OM6 1.31 Å, Crystal structure of FGF2-STAB, a stable variant of human fibroblast growth factor 2
8HUE 1.48 Å, Crystal structure of FGF2-M2 mutant - D28E/C78I/C96I/S137P
4OEE 1.5 Å, Crystal Structure Analysis of FGF2-Disaccharide (S3I2) complex
1BFG 1.6 Å, Crystal structure of basic fibroblast growth factor at 1.6 Å resolution
4FGF 1.6 Å, Refinement of the structure of human basic fibroblast growth factor at 1.6 Å resolution…
4OEG 1.6 Å, Crystal Structure Analysis of FGF2-Disaccharide (S9I2) complex
2FGF 1.77 Å, Three-dimensional structure of human basic fibroblast growth factor, A structural…
4OEF 1.8 Å, Crystal Structure Analysis of FGF2-Disaccharide (S6I2) complex
1BAS 1.9 Å, Three-dimensional structures of acidic and basic fibroblast growth factors
1BFB 1.9 Å, Basic fibroblast growth factor complexed with heparin tetramer fragment
5X1O 1.9 Å, PI(4,5)P2 lipid binding induced a reorientation of FGF2 molecules near membrane surface…
1BFF 2.0 Å, The 154 amino acid form of human basic fibroblast growth factor

Browse structure collections

About this viewer

MolViewer shows 8HU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.