8HXB: MPXV M2 hexamer

Cryo-EM structure of MPXV M2 hexamer in complex with human B7.2. Determined by electron microscopy at 2.7 Å resolution. Released 30 Aug 2023.

Method: Electron microscopy
Resolution: 2.7 Å
Organisms: Monkeypox virus, Homo sapiens
Chains: 12
Atoms: 14,892
Mol. weight: 286.24 kDa
Released: 30 Aug 2023

Explore 8HXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HXB contains 42 α-helices and 144 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and F: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	22-23	2	1
α-helix	24-27	4
β-strand	33-44	12	2
α-helix	51-52	2
β-strand	57-63	7	3
β-strand	66-73	8	3
β-strand	76-83	8	3
β-strand	89-97	9	2
β-strand	101-108	8	2
β-strand	119-125	7	3
β-strand	130-131	2	4
β-strand	133-140	8	3
α-helix	141	1
β-strand	148-154	7	3
β-strand	158-165	8	2
α-helix	174-177	4
β-strand	181-184	4	2
α-helix	188-190	3
β-strand	192-197	6	2
β-strand	214-216	3	2

Chain D: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	11
α-helix	24-27	4
β-strand	33-44	12	12
α-helix	51-52	2
β-strand	57-63	7	13
β-strand	66-73	8	13
β-strand	76-83	8	13
β-strand	89-97	9	12
β-strand	101-108	8	12
β-strand	119-125	7	13
β-strand	130-131	2	8
β-strand	133-140	8	13
α-helix	141	1
β-strand	148-154	7	13
β-strand	158-165	8	12
α-helix	174-177	4
β-strand	181-184	4	12
α-helix	188-190	3
β-strand	192-197	6	12
β-strand	214-216	3	12

Chain E: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	22-23	2	14
α-helix	24-27	4
β-strand	33-44	12	15
α-helix	51-52	2
β-strand	57-63	7	16
β-strand	66-73	8	16
β-strand	76-83	8	16
β-strand	89-97	9	15
β-strand	101-108	8	15
β-strand	119-125	7	16
β-strand	131	1	11
β-strand	133-140	8	16
α-helix	141	1
β-strand	148-154	7	16
β-strand	158-165	8	15
α-helix	174-177	4
β-strand	181-184	4	15
α-helix	188-190	3
β-strand	192-197	6	15
β-strand	214-216	3	15

Chains G, H, I, J, K and L: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	35-39	5	19
α-helix	50-52	3
β-strand	54-58	5	2
β-strand	64-68	5	2
β-strand	73	1	2
β-strand	78	1	2
α-helix	80-82	3
β-strand	86-89	4	19
β-strand	94-98	5	19
β-strand	108-114	7	2
β-strand	120-128	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NFkB inhibitor	A, B, C, D, E, F	protein	203	Monkeypox virus	A0A7H0DN11
T-lymphocyte activation antigen CD86	G, H, I, J, K, L	protein	213	Homo sapiens	P42081 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>8HXB_1 NFkB inhibitor (chains A, B, C, D, E, F)
VEYKNTICPPRQDYRYWYFVAELTIGVNYDINSTIIGECHMSESYIDRNANIVLTGYGLK
INMTIMDTDQRFVAAAEGVGKDNKLSVLLFTTQRLDKVHHNISVTITCMEMNCGTTKYNS
DLPESIHKSSSCDITINGSCVTCVNLETDPTKINPHYLHPKNKYLYHNSEYSMRGSYGVT
FIDELNQCLLDIKELSYDICYRE

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>8HXB_2 T-lymphocyte activation antigen CD86 (chains G, H, I, J, K, L)
LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGR
TSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPIS
NITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSV
SFPDVTSNMTIFCILETDKTRLLSSPFSIELED

Primary citation

Structural and functional insights into the modulation of T cell costimulation by monkeypox virus protein M2. Yang, S., Wang, Y., Yu, F. et al. Nat Commun (2023) 14:5186-5186. DOI 10.1038/s41467-023-40748-2 · PubMed

Other PDB entries of the same protein (UniProt A0A7H0DN11), best resolution first:

8HXA 3.04 Å, Cryo-EM structure of MPXV M2 in complex with human B7.1
8HXC 3.12 Å, Cryo-EM structure of MPXV M2 heptamer in complex with human B7.2

Browse structure collections

About this viewer

MolViewer shows 8HXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.