8IGC: Bak

Crystal structure of Bak bound to Bnip5 BH3. Determined by X-ray diffraction at 1.7 Å resolution. Released 20 Sept 2023.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,535
Mol. weight: 21.55 kDa
Released: 20 Sept 2023

Explore 8IGC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IGC contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	24-45	22
α-helix	55-57	3
α-helix	59-62	4
α-helix	70-100	31
α-helix	107-118	12
α-helix	125-145	21
α-helix	151-165	15
α-helix	167-173	7
α-helix	177-181	5

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	245-265	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2 homologous antagonist/killer	A	protein	164	Homo sapiens	Q16611 (AlphaFold model)
Protein BNIP5	B	protein	26	Homo sapiens	P0C671 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8IGC_1 Bcl-2 homologous antagonist/killer (chains A)
GSMSEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLA
IIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLA
LHVYQHGLTGFLGQVTRFVVDFMLHHSIARWIAQRGGWVAALNL

Sequence of entity 2 (B), FASTA

>8IGC_2 Protein BNIP5 (chains B)
DAIIQMIVELLKRVGDQWEEEQSLAS

Primary citation

Crystal structure of Bak bound to the BH3 domain of Bnip5, a noncanonical BH3 domain-containing protein. Lim, D., Jeong, D.E., Shin, H.C. et al. Proteins (2024) 92:44-51. DOI 10.1002/prot.26568 · PubMed

Other PDB entries of the same protein (UniProt Q16611 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VX1 1.22 Å, Bak L100A
8CZF 1.3 Å, Human BAK in complex with the dF2 peptide
8CZH 1.3 Å, Human BAK in complex with the dM2 peptide
2IMS 1.48 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
2IMT 1.49 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
9CPE 1.49 Å, Structural basis of BAK sequestration by MCL-1 and consequences for apoptosis initiation
5FMI 1.49 Å, Human Bak Q77L
7M5A 1.5 Å, Crystal Structure of human BAK in complex with W3W5_BID
5VWY 1.55 Å, Bak core latch dimer in complex with Bim-h3Pc-RT
5VX0 1.6 Å, Bak in complex with Bim-h3Glg
5VWZ 1.62 Å, Bak in complex with Bim-h3Pc
6UXQ 1.7 Å, Crystal structure of BAK core domain BH3-groove-dimer in complex with POPC and C8E4

Browse structure collections

About this viewer

MolViewer shows 8IGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.