8IXA: Tubulin alpha-1A chain

GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region. Determined by electron microscopy at 4.2 Å resolution. Released 16 Aug 2023.

Method: Electron microscopy
Resolution: 4.2 Å
Organisms: Mus musculus, Homo sapiens
Chains: 27
Atoms: 84,087
Mol. weight: 1308.97 kDa
Ligands: GTP, G2P, ATP
Released: 16 Aug 2023

Explore 8IXA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IXA contains 567 α-helices and 522 β-strands across 27 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains a, S, T, U, V, W, X, Y and Z: 14 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	4
β-strand	10-15	6	5
α-helix	16-18	3
α-helix	20-25	6
β-strand	32-34	3	6
β-strand	38-40	3	6
β-strand	45-47	3	6
β-strand	51-52	2	5
α-helix	58-65	8
α-helix	68-75	8
β-strand	78	1	7
β-strand	79-84	6	5
α-helix	91-95	5
β-strand	97	1	8
β-strand	105	1	8
α-helix	107-121	15
β-strand	126-138	13	5
β-strand	141-144	4	5
β-strand	155-157	3	9
β-strand	163-165	3	9
β-strand	171-172	2	5
α-helix	176-189	14
β-strand	192-193	2	10
β-strand	201-202	2	10
β-strand	205-216	12	5
β-strand	222-231	10	5
α-helix	232-234	3
α-helix	238-241	4
α-helix	246-269	24
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-291	5
β-strand	294	1	7
β-strand	297-302	6	5
α-helix	309-323	15
β-strand	326-327	2	4

Chains A, B, C, D, E, F, G, H and I: 25 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	23
α-helix	10-27	18
α-helix	55-57	3
β-strand	59-61	3	24
β-strand	67-69	3	24
β-strand	71-74	4	23
α-helix	81-85	5
β-strand	98	1	23
α-helix	111-115	5
α-helix	117-119	3
α-helix	121-134	14
β-strand	138-144	7	23
α-helix	150	1
α-helix	151-155	5
α-helix	156-166	11
β-strand	171-177	7	23
α-helix	178-180	3
α-helix	189-203	15
β-strand	206-210	5	23
α-helix	212-218	7
α-helix	219-223	5
α-helix	230-244	15
α-helix	246-249	4
β-strand	254	1	25
α-helix	259-265	7
β-strand	274-276	3	23
β-strand	279	1	23
α-helix	284-288	5
α-helix	294-302	9
α-helix	304-306	3
α-helix	313-315	3
β-strand	318-327	10	23
α-helix	333-343	11
β-strand	349	1	23
β-strand	358-360	3	23
β-strand	361	1	25
α-helix	368-369	2
β-strand	379-387	9	23
α-helix	390-406	17
α-helix	411-417	7
α-helix	421-441	21

Chains J, K, L, M, N, O, P, Q and R: 24 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	26
α-helix	10-27	18
β-strand	30	1	27
β-strand	35	1	28
β-strand	36	1	27
α-helix	47-49	3
β-strand	51-54	4	28
α-helix	55-57	3
β-strand	58-61	4	28
β-strand	63-65	3	26
β-strand	66-67	2	29
α-helix	70-77	8
α-helix	82-84	3
α-helix	87-89	3
β-strand	91-92	2	29
α-helix	101-102	2
α-helix	103-107	5
α-helix	108-125	18
β-strand	130-138	9	26
α-helix	143-147	5
α-helix	148-158	11
β-strand	163-169	7	26
α-helix	181-195	15
β-strand	198-200	3	26
β-strand	202	1	26
α-helix	204-213	10
α-helix	222-236	15
α-helix	239-241	3
β-strand	244-246	3	30
α-helix	250-257	8
β-strand	265-266	2	26
β-strand	269-271	3	30
α-helix	286-293	8
α-helix	305-307	3
β-strand	310-318	9	30
α-helix	323-335	13
α-helix	338-340	3
β-strand	341	1	30
β-strand	349-354	6	30
β-strand	364-371	8	30
α-helix	372-374	3
α-helix	375-389	15
α-helix	396-399	4
α-helix	405-424	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin alpha-1A chain	A, B, C, D, E, F, G, H, I	protein	457	Mus musculus	P68369 (AlphaFold model)
Tubulin beta-2A chain	J, K, L, M, N, O, P, Q, R	protein	457	Mus musculus	Q7TMM9 (AlphaFold model)
Kinesin-1 heavy chain	S, T, U, V, W, X, Y, Z, a	protein	372	Homo sapiens	P33176 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I), FASTA

>8IXA_1 Tubulin alpha-1A chain (chains A, B, C, D, E, F, G, H, I)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIHHHHHHGGGDDSFNTFFS
ETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEI
IDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPA
PQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQI
VSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNA
CFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVG
INYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGME
EGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Sequence of entity 2 (J, K, L, M, N, O, P, Q, R), FASTA

>8IXA_2 Tubulin beta-2A chain (chains J, K, L, M, N, O, P, Q, R)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEAGGSGGDYKDDDK

Sequence of entity 3 (S, T, U, V, W, X, Y, Z, a), FASTA

>8IXA_3 Kinesin-1 heavy chain (chains S, T, U, V, W, X, Y, Z, a)
MGSSHHHHHHSSGLVPRGSHMASMADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGED
TVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEG
KLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHE
DKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENT
QTEQKLSGKLYLVDLAGSAKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPY
RDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTA
EQWKKKYEKEKE

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	9
G2P	Phosphomethylphosphonic acid guanylate ester	C11 H18 N5 O13 P3	9
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	9

Primary citation

Cryo-EM of alpha-tubulin isotype-containing microtubules revealed a contracted structure of alpha 4A/ beta 2A microtubules. Diao, L., Zheng, W., Zhao, Q. et al. Acta Biochim Biophys Sin (Shanghai) (2023) 55:1551-1560. DOI 10.3724/abbs.2023130 · PubMed

Other PDB entries of the same protein (UniProt P68369 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JZD 2.48 Å, Crystal structure of peptide-bound VASH2-SVBP complex
9PND 3.19 Å, In situ microtubule of EpoB-induced regenerating axons
12RU 3.66 Å, In situ cryo-EM structure of axonal microtubules from ghost neurons (expanded lattice)
9XRL 3.74 Å, Structure of mouse cytoplasmic lattice (CPL) repeating unit
12RT 3.96 Å, In situ cryo-EM structure of axonal microtubules from ghost neurons (compact lattice)
8IXB 4.2 Å, GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin seam region
9SFP 4.2 Å, Native cytoplasmic lattices from mouse oocytes
8TO0 7.7 Å, 48-nm repeating structure of doublets from mouse sperm flagella

Browse structure collections

About this viewer

MolViewer shows 8IXA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.