8IXE: Tubulin alpha-1C chain

GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin seam region. Determined by electron microscopy at 4.4 Å resolution. Released 16 Aug 2023.

Method: Electron microscopy
Resolution: 4.4 Å
Organisms: Mus musculus, Homo sapiens
Chains: 12
Atoms: 37,376
Mol. weight: 580.86 kDa
Ligands: GTP, G2P, ATP
Released: 16 Aug 2023

Explore 8IXE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IXE contains 227 α-helices and 233 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 23 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	52
α-helix	11-28	18
β-strand	30	1	53
β-strand	35	1	54
β-strand	36	1	53
α-helix	41-45	5
β-strand	51-54	4	54
α-helix	55-57	3
β-strand	58-61	4	54
β-strand	63-67	5	52
α-helix	70-78	9
α-helix	87-89	3
β-strand	90-92	3	52
α-helix	101-102	2
α-helix	103-107	5
α-helix	108-126	19
β-strand	130-138	9	52
α-helix	143	1
α-helix	144-148	5
α-helix	149-158	10
β-strand	163-170	8	52
α-helix	181-195	15
β-strand	198-203	6	52
α-helix	204-210	7
α-helix	211-215	5
α-helix	222-241	20
β-strand	246	1	55
α-helix	250-257	8
β-strand	265-266	2	52
β-strand	267-271	5	55
α-helix	286-293	8
α-helix	305-307	3
β-strand	310-318	9	55
α-helix	323-336	14
α-helix	338-340	3
β-strand	341	1	55
β-strand	349-354	6	55
β-strand	364-371	8	55
α-helix	374-389	16
α-helix	398-401	4
α-helix	405-424	20

Chains B and H: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	17
α-helix	10-28	19
β-strand	59	1	18
β-strand	69	1	18
β-strand	71-75	5	17
α-helix	79-85	7
β-strand	99-100	2	17
α-helix	109-110	2
α-helix	111-115	5
α-helix	121-133	13
β-strand	138-144	7	17
α-helix	151-166	16
β-strand	171-178	8	17
α-helix	189-203	15
β-strand	206-211	6	17
α-helix	212-221	10
α-helix	230-244	15
α-helix	246-249	4
β-strand	254	1	19
α-helix	258-263	6
β-strand	274-279	6	19
α-helix	284-289	6
α-helix	294-301	8
α-helix	304-306	3
α-helix	313-315	3
β-strand	318-327	10	19
α-helix	331-343	13
β-strand	349	1	19
β-strand	357-362	6	19
α-helix	365-367	3
β-strand	379-387	9	19
α-helix	390-406	17
α-helix	412-415	4
α-helix	422-441	20

Chains h and q: 14 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	24
α-helix	9	1
β-strand	10-15	6	25
α-helix	17-19	3
α-helix	20-23	4
β-strand	29	1	26
β-strand	32-34	3	27
β-strand	38-40	3	27
β-strand	45-47	3	27
β-strand	50-52	3	25
α-helix	58-75	18
β-strand	78	1	28
β-strand	79-85	7	25
β-strand	86	1	29
α-helix	91-95	5
β-strand	97	1	30
β-strand	105	1	30
α-helix	107-121	15
β-strand	126-138	13	25
β-strand	141-144	4	25
β-strand	155-157	3	31
β-strand	163-165	3	31
β-strand	171-173	3	25
α-helix	176-189	14
β-strand	192-193	2	32
β-strand	201-202	2	32
β-strand	206-216	11	25
β-strand	221-231	11	25
α-helix	232-234	3
β-strand	235	1	29
α-helix	238-241	4
α-helix	246-270	25
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-291	5
β-strand	294	1	28
β-strand	297-302	6	25
β-strand	305	1	26
α-helix	309-323	15
β-strand	326-327	2	24

Chain J: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	33
α-helix	10-27	18
β-strand	59-61	3	34
β-strand	67-69	3	34
β-strand	71-75	5	33
α-helix	79-85	7
β-strand	98-100	3	33
α-helix	109-110	2
α-helix	111-115	5
α-helix	121-133	13
β-strand	138-144	7	33
α-helix	151-166	16
β-strand	171-178	8	33
α-helix	189-203	15
β-strand	206-211	6	33
α-helix	212-221	10
α-helix	230-244	15
α-helix	246-249	4
β-strand	254	1	35
α-helix	258-263	6
β-strand	274-279	6	35
α-helix	284-289	6
α-helix	294-301	8
α-helix	304-306	3
α-helix	313-315	3
β-strand	318-327	10	35
α-helix	331-343	13
β-strand	349	1	35
β-strand	357-362	6	35
α-helix	365-367	3
β-strand	379-387	9	35
α-helix	390-406	17
α-helix	412-415	4
α-helix	422-441	20

Chain K: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	49
α-helix	10-28	19
β-strand	59-61	3	50
β-strand	67-69	3	50
β-strand	71-75	5	49
α-helix	79-85	7
β-strand	99-100	2	49
α-helix	109-110	2
α-helix	111-115	5
α-helix	121-133	13
β-strand	138-144	7	49
α-helix	151-166	16
β-strand	171-178	8	49
α-helix	189-203	15
β-strand	206-211	6	49
α-helix	214-221	8
α-helix	230-244	15
α-helix	246-249	4
β-strand	254	1	51
α-helix	258-263	6
β-strand	274-279	6	51
α-helix	284-289	6
α-helix	294-301	8
α-helix	304-306	3
α-helix	313-315	3
β-strand	318-327	10	51
α-helix	331-343	13
β-strand	349	1	51
β-strand	357-362	6	51
α-helix	365-367	3
β-strand	379-387	9	51
α-helix	390-406	17
α-helix	412-415	4
α-helix	422-441	20

Chain l: 15 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	8
α-helix	9	1
β-strand	10-15	6	9
α-helix	17-19	3
α-helix	20-23	4
β-strand	29	1	10
β-strand	32-34	3	11
β-strand	38-40	3	11
β-strand	45-47	3	11
β-strand	50-52	3	9
α-helix	58-65	8
α-helix	67-75	9
β-strand	78	1	12
β-strand	79-85	7	9
β-strand	86	1	13
α-helix	91-95	5
β-strand	97	1	14
β-strand	105	1	14
α-helix	107-121	15
β-strand	126-138	13	9
β-strand	141-144	4	9
β-strand	154-157	4	15
β-strand	163-166	4	15
β-strand	171-173	3	9
α-helix	176-189	14
β-strand	192-193	2	16
β-strand	201-202	2	16
β-strand	206-216	11	9
β-strand	221-231	11	9
α-helix	232-234	3
β-strand	235	1	13
α-helix	238-241	4
α-helix	246-270	25
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-291	5
β-strand	294	1	12
β-strand	297-302	6	9
β-strand	305	1	10
α-helix	309-323	15
β-strand	326-327	2	8

Chain p: 14 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	40
α-helix	9	1
β-strand	10-15	6	41
α-helix	17-19	3
α-helix	20-23	4
β-strand	29	1	42
β-strand	32-34	3	43
β-strand	38-40	3	43
β-strand	45-47	3	43
β-strand	50-52	3	41
α-helix	58-75	18
β-strand	78	1	44
β-strand	79-85	7	41
β-strand	86	1	45
α-helix	91-95	5
β-strand	97	1	46
β-strand	105	1	46
α-helix	107-121	15
β-strand	126-138	13	41
β-strand	141-144	4	41
β-strand	154-157	4	47
β-strand	163-166	4	47
β-strand	171-173	3	41
α-helix	176-189	14
β-strand	192-193	2	48
β-strand	201-202	2	48
β-strand	206-216	11	41
β-strand	221-231	11	41
α-helix	232-234	3
β-strand	235	1	45
α-helix	238-241	4
α-helix	246-270	25
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-291	5
β-strand	294	1	44
β-strand	297-302	6	41
β-strand	305	1	42
α-helix	309-323	15
β-strand	326-327	2	40

Chain R: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	20
α-helix	11-28	18
β-strand	30	1	21
β-strand	35	1	22
β-strand	36	1	21
α-helix	41-45	5
β-strand	51-54	4	22
α-helix	55-57	3
β-strand	58-61	4	22
β-strand	63-67	5	20
α-helix	70-78	9
β-strand	90-92	3	20
α-helix	101-102	2
α-helix	103-107	5
α-helix	108-126	19
β-strand	130-138	9	20
α-helix	143-158	16
β-strand	163-170	8	20
α-helix	181-195	15
β-strand	198-203	6	20
α-helix	204-210	7
α-helix	211-215	5
α-helix	222-241	20
β-strand	246	1	23
α-helix	250-257	8
β-strand	265-266	2	20
β-strand	267-271	5	23
α-helix	276-278	3
α-helix	286-293	8
β-strand	299	1	23
α-helix	305-307	3
β-strand	310-318	9	23
α-helix	323-336	14
α-helix	338-340	3
β-strand	341	1	23
β-strand	349-354	6	23
β-strand	364-371	8	23
α-helix	374-389	16
α-helix	398-401	4
α-helix	405-424	20

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin alpha-1C chain	B, H, J, K	protein	455	Mus musculus	P68373 (AlphaFold model)
Tubulin beta-2A chain	R, W, Z, a	protein	457	Mus musculus	Q7TMM9 (AlphaFold model)
Kinesin-1 heavy chain	h, l, p, q	protein	372	Homo sapiens	P33176 (AlphaFold model)

Sequence of entity 1 (B, H, J, K), FASTA

>8IXE_1 Tubulin alpha-1C chain (chains B, H, J, K)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIHHHHHHGGGDDSFNTFFS
ETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEI
IDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPA
PQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQI
VSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNA
CFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVG
INYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGME
EGEFSEAREDMAALEKDYEEVGADSAEGDDEGEEY

Sequence of entity 2 (R, W, Z, a), FASTA

>8IXE_2 Tubulin beta-2A chain (chains R, W, Z, a)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEAGGSGGDYKDDDK

Sequence of entity 3 (h, l, p, q), FASTA

>8IXE_3 Kinesin-1 heavy chain (chains h, l, p, q)
MGSSHHHHHHSSGLVPRGSHMASMADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGED
TVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEG
KLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHE
DKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENT
QTEQKLSGKLYLVDLAGSAKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPY
RDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTA
EQWKKKYEKEKE

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	4
G2P	Phosphomethylphosphonic acid guanylate ester	C11 H18 N5 O13 P3	4
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	4

Primary citation

Cryo-EM of alpha-tubulin isotype-containing microtubules revealed a contracted structure of alpha 4A/ beta 2A microtubules. Diao, L., Zheng, W., Zhao, Q. et al. Acta Biochim Biophys Sin (Shanghai) (2023) 55:1551-1560. DOI 10.3724/abbs.2023130 · PubMed

Other PDB entries of the same protein (UniProt P68373 (AlphaFold model), which also has an AlphaFold model), best resolution first:

24MC 3.4 Å, Structure of oocyte cytoplasmic lattices
12DL 3.5 Å, Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs
8IXD 4.4 Å, GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin non-seam region
9T63 4.7 Å, Asymmetric unit of a cytoplasmic lattice filament repeat unit
9T66 5.3 Å, Complex linking two repeat units of a cytoplasmic lattice filament
9T64 7.3 Å, Cytoplasmic lattice filament repeat unit with the central FBXW-SKP1 complex
9T67 7.7 Å, Cytoplasmic lattice filament repeat unit with ubiquitin
9T68 8.0 Å, Composite structure of the repeat unit of cytoplasmic lattice filament

Browse structure collections

About this viewer

MolViewer shows 8IXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.