8J2Q: Polyhedrin,Myc proto-oncogene protein

Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment. Determined by X-ray diffraction at 1.92 Å resolution. Released 17 Apr 2024.

Method: X-ray diffraction
Resolution: 1.92 Å
Organisms: Bombyx mori cytoplasmic polyhedrosis virus, Homo sapiens
Chains: 1
Atoms: 1,533
Mol. weight: 28.33 kDa
Released: 17 Apr 2024

Explore 8J2Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8J2Q contains 11 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	12-28	17
β-strand	34-43	10	1
β-strand	48-56	9	1
β-strand	58-65	8	2
β-strand	68	1	3
β-strand	104	1	3
β-strand	106-113	8	1
β-strand	117	1	4
α-helix	119-121	3
β-strand	123-126	4	2
α-helix	137-139	3
β-strand	144-145	2	2
α-helix	147-149	3
α-helix	150	1
β-strand	151-155	5	1
β-strand	158-167	10	1
α-helix	168-169	2
β-strand	175-182	8	2
β-strand	183	1	4
α-helix	186-189	4
α-helix	197-206	10
β-strand	208-214	7	1
α-helix	217-220	4
α-helix	221-225	5
α-helix	226-228	3
β-strand	232-233	2	5
β-strand	239-240	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyhedrin,Myc proto-oncogene protein	A	protein	248	Bombyx mori cytoplasmic polyhedrosis virus, Homo sapiens	P01106 (AlphaFold model), P11041

Sequence of entity 1 (A), FASTA

>8J2Q_1 Polyhedrin,Myc proto-oncogene protein (chains A)
MADVAGTSNRDFRGYILSVQAEEQKNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVG
ISETFKALKEYREGQHNDSYDEYEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVR
TIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRDGEIVGYSHYFELPHEYNSISLAVS
GVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSY
GVALSNRQ

Primary citation

High-throughput structure determination of an intrinsically disordered protein using cell-free protein crystallization. Kojima, M., Abe, S., Furuta, T. et al. Proc Natl Acad Sci U S A (2024) 121:e2322452121-e2322452121. DOI 10.1073/pnas.2322452121 · PubMed

Other PDB entries of the same protein (UniProt P01106 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QNH 1.3 Å, Myc pS294 phosphopeptide binding to 14-3-3sigma
6G6K 1.35 Å, The crystal structures of Human MYC:MAX bHLHZip complex
1NKP 1.8 Å, Crystal structure of Myc-Max recognizing DNA
8Q1N 1.84 Å, Cyclic peptide binder of the WBM-site of WDR5
4Y7R 1.9 Å, Crystal structure of WDR5 in complex with MYC MbIIIb peptide
5I4Z 1.95 Å, Structure of apo OmoMYC
8X8V 2.0 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
8X8S 2.04 Å, Crystal structure of Cypovirus Polyhedra mutant fused with c-Myc fragment
1EE4 2.1 Å, Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls…
6G6L 2.2 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6G6J 2.25 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6E16 2.4 Å, Ternary structure of c-Myc-TBP-TAF1

Browse structure collections

About this viewer

MolViewer shows 8J2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.