8JGA: Mi3 fused with FKBP

Cryo-EM structure of Mi3 fused with FKBP. Determined by electron microscopy at 3.68 Å resolution. Released 24 Apr 2024.

Method: Electron microscopy
Resolution: 3.68 Å
Organisms: Homo sapiens, Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Chains: 1
Atoms: 1,516
Mol. weight: 36.73 kDa
Released: 24 Apr 2024

Explore 8JGA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JGA contains 11 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
β-strand	12	1	1
β-strand	14-15	2	2
α-helix	21-34	14
β-strand	38-42	5	2
α-helix	48-55	8
α-helix	57-61	5
β-strand	64-68	5	2
α-helix	73-81	9
β-strand	86-88	3	2
α-helix	94-103	10
β-strand	106-108	3	2
β-strand	110	1	3
α-helix	114-123	10
β-strand	127-129	3	3
α-helix	133-136	4
α-helix	138-144	7
β-strand	152-154	3	3
α-helix	164-168	5
β-strand	172	1	3
β-strand	175	1	1
α-helix	186-201	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase FKBP1A,2-dehydro-3-deoxyphosphogluconate…	A	protein	344	Homo sapiens, Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)	P62942 (AlphaFold model), Q9WXS1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8JGA_1 Peptidyl-prolyl cis-trans isomerase FKBP1A,2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (chains A)
MGSSHHHHHHGGSGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFK
FMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
GGSGGSGGSGGSMKMEELFKKHKIVAVLRANSVEEAKKKALAVFLGGVHLIEITFTVPDA
DTVIKELSFLKEMGAIIGAGTVTSVEQARKAVESGAEFIVSPHLDEEISQFAKEKGVFYM
PGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWF
KAGVLAVGVGSALVKGTPVEVAEKAKAFVEKIRGCTEGSGEPEA

Primary citation

Dynamic Metabolons Using Stimuli-Responsive Protein Cages. Kang, W., Ma, X., Zhang, H. et al. J Am Chem Soc (2024) 146:6686-6696. DOI 10.1021/jacs.3c12876 · PubMed

Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PPN 0.92 Å, Crystal structure of FKBP12
2PPP 0.94 Å, Crystal structure of E60Q mutant of FKBP12
6YF3 1.0 Å, FKBP12 in complex with the BMP potentiator compound 10 at 1.00A resolution
6YF2 1.03 Å, FKBP12 in complex with the BMP potentiator compound 6 at 1.03A resolution
8X6P 1.05 Å, Isomerase Protein
6YF1 1.12 Å, FKBP12 in complex with the BMP potentiator compound 8 at 1.12A resolution
8CHM 1.12 Å, Human FKBP12 in complex with (1S,5S,6R)-10-((S)-(3,5-dichlorophenyl)sulfinyl)-3-(pyridin-…
4N19 1.2 Å, Structural basis of conformational transitions in the active site and 80 s loop in the…
8PDF 1.2 Å, FKBP12 in complex with PROTAC 6a2
9LYG 1.26 Å, Crystal structure of FKBP12 complexed with Small Molecule Anchor for Protein-201
2PPO 1.29 Å, Crystal structure of E60A mutant of FKBP12
7U8D 1.39 Å, FKBP12 mutant V55G bound to Rapa*-3Z

Browse structure collections

About this viewer

MolViewer shows 8JGA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.