Structure of truncated form of nanobody in complex with alpha-synuclein peptide. Determined by X-ray diffraction at 1.23 Å resolution. Released 10 Jan 2024.
Explore 8JJV in 3D Show helices and sheets RCSB PDB PDBe
8JJV contains 3 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-13 | 3 | 1 |
| β-strand | 18-23 | 6 | 2 |
| α-helix | 26-31 | 6 | |
| β-strand | 34-39 | 6 | 3 |
| β-strand | 46-51 | 6 | 3 |
| β-strand | 57-59 | 3 | 3 |
| β-strand | 67-71 | 5 | 2 |
| β-strand | 77-82 | 6 | 2 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-97 | 7 | 3 |
| α-helix | 102-106 | 5 | |
| β-strand | 109 | 1 | 2 |
| β-strand | 111-113 | 3 | 3 |
| β-strand | 114-116 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 3 |
| β-strand | 7-10 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nanobody | A | protein | 130 | Camelus dromedarius | |
| Alpha-synuclein peptide | B | protein | 14 | Homo sapiens | P37840 (AlphaFold model) |
>8JJV_1 Nanobody (chains A) QVQLQESGGGSVQAGGSLRLSCTISDAIFSRYAVGWFRQAPGKECELVSTITPDSTTTHS DFVKGRFTLSRDNAKNTVYLQMHSLKPDDTAVYYCASRWRSVSEGCGGQGTQVTVSSAAA YPYDVPDYGS
>8JJV_2 Alpha-synuclein peptide (chains B) KTKEGVVHGVATVA
Structural insights into the unique recognition module between alpha-synuclein peptide and nanobody. Islam, Z., Vaikath, N.N., Hmila, I. et al. Protein Sci (2024) 33:e4875-e4875. DOI 10.1002/pro.4875 · PubMed
Other PDB entries of the same protein (UniProt P37840 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8JJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.