8JPE: PDB entry 8JPE

Focused refinement structure of Galpha(q) in NTSR1-GRK2-Galpha(q) complexes. Determined by electron microscopy at 2.91 Å resolution. Released 9 Aug 2023.

Method: Electron microscopy
Resolution: 2.91 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,189
Mol. weight: 41.85 kDa
Ligands: ALF, MG, GDP
Released: 9 Aug 2023

Explore 8JPE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JPE contains 22 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain Q: 22 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	39	1
β-strand	40-46	7	1
α-helix	52-63	12
α-helix	69-97	29
α-helix	99-101	3
α-helix	104-115	12
α-helix	126-137	12
α-helix	139-146	8
α-helix	148-150	3
α-helix	157-163	7
α-helix	165-168	4
α-helix	176-180	5
β-strand	190-192	3	1
β-strand	195	1	2
β-strand	200	1	2
β-strand	201-205	5	1
α-helix	210-213	4
α-helix	216-219	4
β-strand	223-231	9	1
α-helix	232-235	4
β-strand	238	1	3
α-helix	239	1
β-strand	246	1	3
α-helix	247-260	14
α-helix	262-264	3
β-strand	268-274	7	1
α-helix	276-285	10
α-helix	288-291	4
α-helix	298	1
α-helix	302-315	14
β-strand	324-328	5	1
α-helix	334-351	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(q) subunit alpha	Q	protein	353	Homo sapiens	P50148 (AlphaFold model)

Sequence of entity 1 (Q), FASTA

>8JPE_1 Guanine nucleotide-binding protein G(q) subunit alpha (chains Q)
MGCTLSAEDKAAVERSKMIDRNLREDGERSRRELKLLLLGTGESGKSTFIKQMRIIHGSG
YSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFEN
PYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPT
TGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNEN
RMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAR
EFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV

Ligands and cofactors

ID	Name	Formula	Copies
ALF	Tetrafluoroaluminate ion	Al F4	1
MG	Magnesium ion	Mg	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

GPCR activation and GRK2 assembly by a biased intracellular agonist. Duan, J., Liu, H., Zhao, F. et al. Nature (2023) 620:676-681. DOI 10.1038/s41586-023-06395-9 · PubMed

Other PDB entries of the same protein (UniProt P50148 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9VAW 2.24 Å, Cryo-EM structure of human Neurotensin Receptor 1 (hNTSR1)-Gq (delipidated) complex in…
9M1H 2.55 Å, Cryo-EM structure of PGE2-EP1-Gq complex
9XIX 2.58 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the C-state
8THK 2.6 Å, Cryo-EM structure of A61603-bound alpha-1A-adrenergic receptor in complex with…
9XH2 2.6 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the E-state
8G59 2.64 Å, Cryo-EM structure of the TUG891 bound GPR120-Giq complex
24XB 2.65 Å, Cryo-EM Structure of the Apo FFAR4-Gq Complex
8XGO 2.68 Å, a peptide receptor complex structure
9K27 2.68 Å, PrRP31 bound prolactin-releasing peptide receptor coupled with Gq protein complex
9XJP 2.74 Å, Structure of the CX3CL1.44-US28-GqiN18-scFv16 in the E-state, chemokine domain fully…
9LL9 2.76 Å, DOI-bound Serotonin 2A (5-HT2A) receptor-Gq complex
7F6I 2.8 Å, Cryo-EM structure of human bradykinin receptor BK2R in complex Gq proteins and kallidin

Browse structure collections

About this viewer

MolViewer shows 8JPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.