8JR5: Glycoprotein G

Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N. Determined by X-ray diffraction at 3.3 Å resolution. Released 19 Jun 2024.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Hendra virus (isolate Horse/Autralia/Hendra/1994)
Chains: 2
Atoms: 6,451
Mol. weight: 94.92 kDa
Ligands: NAG
Released: 19 Jun 2024

Explore 8JR5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JR5 contains 9 α-helices and 66 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	1
β-strand	215-225	11	2
β-strand	228-237	10	2
α-helix	243	1
β-strand	244-257	14	2
β-strand	263-271	9	2
β-strand	279-287	9	3
β-strand	290-297	8	3
α-helix	307-309	3
β-strand	313-320	8	3
β-strand	332-335	4	3
β-strand	340-341	2	4
β-strand	348-350	3	4
β-strand	354	1	3
β-strand	356-358	3	4
β-strand	361-371	11	4
α-helix	379-381	3
α-helix	394-397	4
β-strand	407-417	11	4
β-strand	426-430	5	4
β-strand	431	1	5
β-strand	442-447	6	6
β-strand	450-455	6	6
β-strand	465-471	7	6
β-strand	475	1	5
β-strand	476-479	4	6
β-strand	509	1	1
β-strand	511-515	5	7
β-strand	520-526	7	7
β-strand	533	1	8
β-strand	535-541	7	7
β-strand	544-550	7	7
β-strand	557	1	8
β-strand	558-568	11	1
β-strand	571-580	10	1
β-strand	581	1	9
β-strand	588	1	9
β-strand	591-596	6	1
α-helix	597-598	2

Chain B: 4 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	201-202	2	10
β-strand	215-225	11	11
β-strand	228-237	10	11
β-strand	244-257	14	11
β-strand	263-271	9	11
β-strand	279-287	9	12
β-strand	290-297	8	12
α-helix	307-309	3
β-strand	313-320	8	12
β-strand	332-337	6	12
β-strand	341	1	13
β-strand	348-350	3	13
β-strand	354	1	12
β-strand	356-358	3	13
β-strand	361-371	11	13
α-helix	372-374	3
α-helix	379-381	3
α-helix	394-397	4
β-strand	407-417	11	13
β-strand	427-429	3	13
β-strand	431	1	14
β-strand	442-447	6	15
β-strand	450-455	6	15
β-strand	463	1	16
β-strand	465-471	7	15
β-strand	475	1	14
β-strand	476-479	4	15
β-strand	486	1	16
β-strand	509	1	10
β-strand	511-515	5	17
β-strand	520-526	7	17
β-strand	535-541	7	17
β-strand	544-550	7	17
β-strand	558-568	11	10
β-strand	571-581	11	10
β-strand	588-596	9	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycoprotein G	A, B	protein	416	Hendra virus (isolate Horse/Autralia/Hendra/1994)	O89343 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8JR5_1 Glycoprotein G (chains A, B)
ICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLEKIGSCTRGIAKQ
RIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPILNS
TSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSGIKQGDTLYFPAV
GFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSLGGDIILQ
FIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSVISR
PGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNEILY
QVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDNVIRPKLFAVKIPAQCSE

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Single amino acid substitution in Hendra virus attachment glycoprotein induces cross-neutralizing antibodies against Nipah virus. Li, Y., Huang, X., Li, R. et al. Signal Transduct Target Ther (2025) 10:276-276. DOI 10.1038/s41392-025-02370-0 · PubMed

Other PDB entries of the same protein (UniProt O89343 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VY4 2.0 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6PD4 2.2 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein
6VY6 2.6 Å, Crystal structure of Hendra receptor binding protein head domain in complex with human…
6CMG 2.7 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
6PDL 2.7 Å, Crystal Structure of Hendra Virus Attachment G Glycoprotein in Complex with Receptor…
6CMI 2.72 Å, Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent…
7SYY 2.74 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
7SYZ 2.86 Å, Hendra virus G protein head domain in complex with cross-neutralizing murine antibody…
2X9M 2.9 Å, Hendra virus attachment glycoprotein
8VF1 3.0 Å, Crystal Structure of the Hendra Virus Attachment G glycoprotein (HeV-G)
8JR3 3.22 Å, Crystal structure of Hendra Virus attachment(G) glycoprotein mutant S586N in complex…
2VSK 3.3 Å, Hendra virus attachment glycoprotein in complex with human cell surface receptor ephrinB2

Browse structure collections

About this viewer

MolViewer shows 8JR5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.