8JZW: Cystal structure of HP1

Cystal structure of HP1 in complex with TRIM66 peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Jul 2024.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 6
Atoms: 2,368
Mol. weight: 41.09 kDa
Released: 10 Jul 2024

Explore 8JZW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JZW contains 18 α-helices and 20 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	116-119	4
α-helix	121-122	2
β-strand	123-130	8	4
β-strand	137-142	6	4
β-strand	149-152	4	4
α-helix	153-159	7
α-helix	161-169	9
β-strand	172-174	3	5

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	116-119	4
α-helix	121-122	2
β-strand	123-130	8	6
β-strand	137-142	6	6
β-strand	149-152	4	6
α-helix	153-159	7
α-helix	161-171	11
β-strand	172-174	3	5

Chain C: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	116-119	4
α-helix	121-122	2
β-strand	123-130	8	1
β-strand	137-142	6	1
β-strand	149-152	4	1
α-helix	153-159	7
α-helix	161-169	9
β-strand	172-173	2	2

Chain D: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	116-119	4
α-helix	121-122	2
β-strand	123-130	8	3
β-strand	137-142	6	3
β-strand	149-152	4	3
α-helix	153-159	7
α-helix	161-171	11
β-strand	172-173	2	2

Chain E: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
α-helix	858-859	2
β-strand	860-864	5	5
β-strand	866	1	6

Chain F: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
α-helix	858-860	3
β-strand	861-863	3	2
β-strand	866	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox homolog 3 (HP1 gamma homolog, Drosophila)	A, B, C, D	protein	80	Homo sapiens	Q13185 (AlphaFold model)
Asn-ser-glu-his-lys-ile-pro-tyr-val-arg-leu-glu-arg-leu-lys-ile-cys-ala	E, F	protein	18	Homo sapiens	O15016 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8JZW_1 Chromobox homolog 3 (HP1 gamma homolog, Drosophila) (chains A, B, C, D)
HHHHHHMAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQ
IVIAFYEERLTWHSCPEDEA

Sequence of entity 2 (E, F), FASTA

>8JZW_2 ASN-SER-GLU-HIS-LYS-ILE-PRO-TYR-VAL-ARG-LEU-GLU-ARG-LEU-LYS-ILE-CYS-ALA (chains E, F)
NSEHKIPYVRLERLKICA

Primary citation

Cystal structure of HP1 in complex with TRIM66 peptide. Shen, S.Y., Li, F.D., Shi, Y.Y. To be published.

Other PDB entries of the same protein (UniProt Q13185 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T1I 1.6 Å, CBX3 chromo shadow domain in complex with histone H3 peptide
3KUP 1.77 Å, Crystal Structure of the CBX3 Chromo Shadow Domain
9OSC 1.77 Å, Crystal structure of HP1gamma chromoshadow domain in complex with KAP1 peptide
3TZD 1.81 Å, Crystal structure of the complex of Human Chromobox Homolog 3 (CBX3)
6HW2 1.94 Å, The Crystal Structure of CaV beta4c in complex with HP1gamma chromo shadow domains
3DM1 2.4 Å, Crystal structure of the complex of human chromobox homolog 3 (CBX3) with peptide
2L11 Solution NMR structure of the Cbx3 in complex with H3K9me3 peptide

Browse structure collections

About this viewer

MolViewer shows 8JZW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.