8K6Q: HOIL-1L LTM domain

Crystal structure of HOIL-1L LTM domain. Determined by X-ray diffraction at 1.59 Å resolution. Released 3 Jul 2024.

Method: X-ray diffraction
Resolution: 1.59 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,723
Mol. weight: 24.66 kDa
Released: 3 Jul 2024

Explore 8K6Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8K6Q contains 10 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	-1-21	23
α-helix	24-37	14
β-strand	41-45	5	2
α-helix	46-49	4

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	-1-20	22
α-helix	24-37	14
β-strand	41-45	5	1
α-helix	46-48	3

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	3-21	19
α-helix	24-37	14
β-strand	41-45	5	2

Chain D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	3-21	19
α-helix	24-36	13
β-strand	41-45	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RanBP-type and C3HC4-type zinc finger-containing protein 1	A, B, C, D	protein	57	Homo sapiens	Q9BYM8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8K6Q_1 RanBP-type and C3HC4-type zinc finger-containing protein 1 (chains A, B, C, D)
GPGSEFMDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSP

Primary citation

Mechanistic insights into the homo-dimerization of HOIL-1L and SHARPIN. Zhang, Y., Xu, X., Wang, Y. et al. Biochem Biophys Res Commun (2023) 689:149239-149239. DOI 10.1016/j.bbrc.2023.149239 · PubMed

Other PDB entries of the same protein (UniProt Q9BYM8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EGW 1.78 Å, HOIL-1 RING2 domain bound to ubiquitin-maltose (maltose not modelled)
7YUJ 1.86 Å, Crystal structure of HOIL-1L(365-510)
7V8E 1.9 Å, Crystal structure of IpaH1.4 LRR domain bound to HOIL-1L UBL domain.
9EGV 2.0 Å, HOIL-1 RING2 domain bound to ubiquitin
8BVL 2.24 Å, Crystal structure of the IBR-RING2 domain of HOIL-1
7YUI 2.6 Å, Crystal structure of HOIL-1L(195-423) in complex with the linear tetra-ubiquitin
4DBG 2.71 Å, Crystal structure of HOIL-1L-UBL complexed with a HOIP-UBA derivative
8EAZ 3.08 Å, HOIL-1/E2-Ub/Ub transthiolation complex
2CRC Solution structure of the zf-RanBP domain of the protein HBV associated factor
2LGY Ubiquitin-like domain from HOIL-1

Browse structure collections

About this viewer

MolViewer shows 8K6Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.