8OE0: Interleukin-12 subunit alpha

Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling complex (Class 2). Determined by electron microscopy at 4.6 Å resolution. Released 7 Feb 2024.

Method: Electron microscopy
Resolution: 4.6 Å
Organism: Mus musculus
Chains: 4
Atoms: 11,980
Mol. weight: 212.95 kDa
Ligands: NAG
Released: 7 Feb 2024

Explore 8OE0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8OE0 contains 25 α-helices and 125 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	33-54	22
α-helix	77-80	4
α-helix	116-143	28
α-helix	154-166	13
α-helix	186-213	28

Chain B: 1 helix, 31 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	1
β-strand	30-36	7	1
β-strand	44-49	6	2
β-strand	59-62	4	1
β-strand	74-79	6	2
α-helix	82-84	3
β-strand	86-92	7	1
β-strand	95-108	14	1
β-strand	111-112	2	1
β-strand	117-118	2	3
β-strand	127-129	3	3
β-strand	130	1	4
β-strand	136-143	8	3
β-strand	149-154	6	1
β-strand	165	1	5
β-strand	173	1	3
β-strand	177	1	6
β-strand	184	1	6
β-strand	185-192	8	3
β-strand	193	1	5
β-strand	206-214	9	1
β-strand	217-225	9	1
β-strand	231	1	4
β-strand	240-242	3	7
β-strand	250-252	3	7
β-strand	268-269	2	8
β-strand	270-271	2	9
β-strand	272-274	3	10
β-strand	295-296	2	9
β-strand	310-312	3	10
β-strand	315-316	2	8
β-strand	329	1	10

Chain C: 6 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	47-54	8	11
β-strand	61-68	8	11
β-strand	74-82	9	12
β-strand	94-99	6	12
β-strand	106-108	3	11
β-strand	119-128	10	12
β-strand	131-134	4	12
β-strand	138-141	4	12
β-strand	156-160	5	13
β-strand	163-168	6	13
β-strand	177-183	7	14
β-strand	189-193	5	14
β-strand	214-218	5	13
β-strand	225-232	8	14
β-strand	234	1	15
β-strand	240	1	15
α-helix	244-247	4
β-strand	251-253	3	14
α-helix	262-264	3
β-strand	275-279	5	16
β-strand	303-310	8	17
β-strand	320-324	5	17
β-strand	328-332	5	16
β-strand	336-343	8	17
β-strand	348-356	9	17
β-strand	368-370	3	18
β-strand	375-379	5	18
β-strand	389-395	7	19
β-strand	405-407	3	19
β-strand	420-424	5	18
β-strand	434-441	8	19
β-strand	452-460	9	19
α-helix	464-467	4
β-strand	474-477	4	20
β-strand	483-486	4	20
α-helix	491-493	3
β-strand	499-501	3	21
β-strand	502-508	7	22
β-strand	514-519	6	22
β-strand	525-528	4	20
α-helix	531-532	2
β-strand	537-541	5	22
β-strand	544-545	2	21
α-helix	549-552	4
β-strand	556-558	3	22

Chain D: 13 helices, 55 β-strands

Element	Residues	Length	Sheet
β-strand	32-36	5	23
β-strand	40-42	3	24
β-strand	47-52	6	23
β-strand	69-74	6	24
β-strand	78-80	3	24
α-helix	91-93	3
β-strand	94-99	6	23
α-helix	102-103	2
β-strand	106-112	7	24
β-strand	125-134	10	24
α-helix	136-138	3
β-strand	141-146	6	25
β-strand	147-148	2	26
β-strand	155-159	5	25
β-strand	168-176	9	27
β-strand	180-188	9	27
β-strand	196-198	3	25
β-strand	211-219	9	27
β-strand	225	1	27
β-strand	230-233	4	27
α-helix	234-237	4
β-strand	238-239	2	26
α-helix	240-243	4
β-strand	244-250	7	28
β-strand	258-263	6	28
β-strand	270-277	8	29
α-helix	283	1
β-strand	284-289	6	29
β-strand	294-297	4	28
β-strand	305-313	9	29
α-helix	326-327	2
β-strand	328-331	4	29
α-helix	332-334	3
β-strand	344	1	30
β-strand	347-348	2	30
β-strand	355-360	6	30
β-strand	375	1	31
β-strand	376-382	7	32
β-strand	387-393	7	32
β-strand	397-402	6	30
β-strand	408-412	5	32
β-strand	415-416	2	31
β-strand	419-420	2	31
β-strand	424-428	5	32
β-strand	439	1	33
α-helix	441-442	2
β-strand	443-448	6	34
β-strand	451-455	5	34
α-helix	457-458	2
β-strand	459	1	33
β-strand	469-472	4	35
β-strand	488-491	4	35
β-strand	497-500	4	34
β-strand	508	1	36
β-strand	510-516	7	35
β-strand	523-529	7	35
β-strand	544-548	5	37
β-strand	551-555	5	37
α-helix	561-563	3
β-strand	566	1	36
β-strand	570-577	8	38
α-helix	583-584	2
β-strand	585-590	6	38
β-strand	597-600	4	37
β-strand	609-616	8	38
β-strand	621	1	38
α-helix	622-624	3
β-strand	628-630	3	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit alpha	A	protein	231	Mus musculus	P43431 (AlphaFold model)
Interleukin-12 subunit beta	B	protein	313	Mus musculus	P43432 (AlphaFold model)
Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1	C	protein	572	Mus musculus	P53355 (AlphaFold model)
Interleukin-12 receptor subunit beta-2,Calmodulin-1	D	protein	769	Mus musculus	P0DP26 (AlphaFold model), P97378

Sequence of entity 1 (A), FASTA

>8OE0_1 Interleukin-12 subunit alpha (chains A)
RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCL
PLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQ
NHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRV
VTINRVMGYLSSAGTSDEVDGGSGGSGLNDIFEAQKIEWHEGRTKHHHHHH

Sequence of entity 2 (B), FASTA

>8OE0_2 Interleukin-12 subunit beta (chains B)
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEF
LDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWL
VQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEE
TLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTP
HSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSS
CSKWACVPCRVRS

Sequence of entity 3 (C), FASTA

>8OE0_3 Interleukin-12 receptor subunit beta-1,Death-associated protein kinase 1 (chains C)
QLGASGPGDGCCVEKTSFPEGASGSPLGPRNLSCYRVSKTDYECSWQYDGPEDNVSHVLW
CCFVPPNHTHTGQERCRYFSSGPDRTVQFWEQDGIPVLSKVNFWVESRLGNRTMKSQKIS
QYLYNWTKTTPPLGHIKVSQSHRQLRMDWNVSEEAGAEVQFRRRMPTTNWTLGDCGPQVN
SGSGVLGDIRGSMSESCLCPSENMAQEIQIRRRRRLSSGAPGGPWSDWSMPVCVPPEVLP
QAKIKFLVEPLNQGGRRRLTMQGQSPQLAVPEGCRGRPGAQVKKHLVLVRMLSCRCQAQT
SKTVPLGKKLNLSGATYDLNVLAKTRFGRSTIQKWHLPAQELTETRALNVSVGGNMTSMQ
WAAQAPGTTYCLEWQPWFQHRNHTHCTLIVPEEEDPAKMVTHSWSSKPTLEQEECYRITV
FASKNPKNPMLWATVLSSYYFGGNASRAGTPRHVSVRNQTGDSVSVEWTASQLSTCPGVL
TQYVVRCEAEDGAWESEWLVPPTKTQVTLDGLRSRVMYKVQVRADTARLPGAWSHPQRFS
FEGTGGSGGSGGAARKKWKQSVRLISLCQRLS

Sequence of entity 4 (D), FASTA

>8OE0_4 Interleukin-12 receptor subunit beta-2,Calmodulin-1 (chains D)
NIDVCKLGTVTVQPAPVIPLGSAANISCSLNPKQGCSHYPSSNELILLKFVNDVLVENLH
GKKVHDHTGHSSTFQVTNLSLGMTLFVCKLNCSNSQKKPPVPVCGVEISVGVAPEPPQNI
SCVQEGENGTVACSWNSGKVTYLKTNYTLQLSGPNNLTCQKQCFSDNRQNCNRLDLGINL
SPDLAESRFIVRVTAINDLGNSSSLPHTFTFLDIVIPLPPWDIRINFLNASGSRGTLQWE
DEGQVVLNQLRYQPLNSTSWNMVNATNAKGKYDLRDLRPFTEYEFQISSKLHLSGGSWSN
WSESLRTRTPEEEPVGILDIWYMKQDIDYDRQQISLFWKSLNPSEARGKILHYQVTLQEV
TKKTTLQNTTRHTSWTRVIPRTGAWTASVSAANSKGASAPTHINIVDLCGTGLLAPHQVS
AKSENMDNILVTWQPPKKADSAVREYIVEWRALQPGSITKFPPHWLRIPPDNMSALISEN
IKPYICYEIRVHALSESQGGCSSIRGDSKHKAPVSGPHITAITEKKERLFISWTHIPFPE
QRGCILHYRIYWKERDSTAQPELCEIQYRRSQNSHPISSLQPRVTYVLWMTAVTAAGESP
QGNEREFCPQGKANGTGGSGGSGGLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSL
GQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGY
ISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Structures of complete extracellular receptor assemblies mediated by IL-12 and IL-23. Bloch, Y., Felix, J., Merceron, R. et al. Nat Struct Mol Biol (2024) 31:591-597. DOI 10.1038/s41594-023-01190-6 · PubMed

Other PDB entries of the same protein (UniProt P43431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CR6 2.85 Å, mouse Interleukin-12
8PB1 3.5 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
8ODZ 3.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…

Browse structure collections

About this viewer

MolViewer shows 8OE0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.