8CR6: Mouse Interleukin-12

mouse Interleukin-12. Determined by X-ray diffraction at 2.85 Å resolution. Released 7 Feb 2024.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,639
Mol. weight: 67.49 kDa
Ligands: NAG
Released: 7 Feb 2024

Explore 8CR6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CR6 contains 13 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	24-25	2	1
β-strand	30-35	6	1
α-helix	42-43	2
β-strand	44-49	6	2
β-strand	60-61	2	1
β-strand	70	1	1
β-strand	74-79	6	2
α-helix	82-84	3
β-strand	87-90	4	1
β-strand	99-106	8	1
β-strand	107-108	2	3
β-strand	111-112	2	3
β-strand	117-118	2	4
β-strand	127-129	3	4
β-strand	130	1	5
β-strand	136-143	8	4
β-strand	150-155	6	1
β-strand	165-167	3	4
β-strand	171-178	8	4
β-strand	183-193	11	4
α-helix	194-195	2
α-helix	205	1
β-strand	206-214	9	1
β-strand	217-225	9	1
α-helix	227-230	4
β-strand	231	1	5
α-helix	233-236	4
β-strand	237-243	7	6
β-strand	249-254	6	6
β-strand	268-274	7	7
β-strand	294-296	3	7
β-strand	300-303	4	6
β-strand	309-316	8	7
α-helix	322-326	5
β-strand	327-330	4	7

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	33-54	22
α-helix	77-80	4
α-helix	84-86	3
α-helix	114-143	30
α-helix	153-167	15
α-helix	184-212	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit beta	A	protein	335	Mus musculus	P43432 (AlphaFold model)
Interleukin-12 subunit alpha	B	protein	253	Mus musculus	P43431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8CR6_1 Interleukin-12 subunit beta (chains A)
MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITW
TSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF
KNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLD
QRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQ
MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS
TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Sequence of entity 2 (B), FASTA

>8CR6_2 Interleukin-12 subunit alpha (chains B)
MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSC
TAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCL
GSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVG
EADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSAGTSDEVDGGSGGSGLNDIFEAQKIE
WHEGRTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Structures of complete extracellular receptor assemblies mediated by IL-12 and IL-23. Bloch, Y., Felix, J., Merceron, R. et al. Nat Struct Mol Biol (2024) 31:591-597. DOI 10.1038/s41594-023-01190-6 · PubMed

Other PDB entries of the same protein (UniProt P43432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CR5 2.15 Å, Murine Interleukin-12 receptor beta 1 domain 1 in complex with murine Interleukin-12 beta.
6SFF 2.4 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group I41
6SP3 3.0 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 1
7R3N 3.16 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 3
6SMC 3.5 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P1
8PB1 3.5 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
8ODZ 3.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
7PUR 3.9 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 2
8OE0 4.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…

Browse structure collections

About this viewer

MolViewer shows 8CR6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.