8OOA: Histone H3.1
CryoEM Structure INO80core Hexasome complex Hexasome refinement state1. Determined by electron microscopy at 3.18 Å resolution. Released 26 Jul 2023.
- Method
- Electron microscopy
- Resolution
- 3.18 Å
- Organisms
- synthetic construct, Homo sapiens
- Chains
- 8
- Atoms
- 8,405
- Mol. weight
- 220.52 kDa
- Released
- 26 Jul 2023
Explore 8OOA in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8OOA contains 30 α-helices and 14 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain M: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 1 |
| α-helix | 86-112 | 27 | |
| α-helix | 113-115 | 3 | |
| β-strand | 118-119 | 2 | 2 |
| α-helix | 121-131 | 11 | |
Chain N: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 48-75 | 28 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-94 | 12 | |
Chain O: 9 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-14 | 3 | |
| α-helix | 17-21 | 5 | |
| α-helix | 27-36 | 10 | |
| β-strand | 42-43 | 2 | 3 |
| α-helix | 47-72 | 26 | |
| β-strand | 77-78 | 2 | 4 |
| α-helix | 79 | 1 | |
| α-helix | 80-88 | 9 | |
| α-helix | 93-96 | 4 | |
| β-strand | 100-102 | 3 | 5 |
| α-helix | 113-115 | 3 | |
| α-helix | 117-118 | 2 | |
Chain P: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-42 | 8 | |
| β-strand | 50-51 | 2 | 4 |
| α-helix | 53-80 | 28 | |
| β-strand | 85-86 | 2 | 3 |
| α-helix | 88-98 | 11 | |
| α-helix | 101-121 | 21 | |
Chain Q: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-42 | 2 | |
| α-helix | 45-54 | 10 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 6 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 7 |
| α-helix | 121-130 | 10 | |
Chain R: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 7 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 6 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA strand 1 | K | DNA | 226 | synthetic construct | |
| DNA Strand 2 | L | DNA | 226 | synthetic construct | |
| Histone H3.1 | M, Q | protein | 135 | Homo sapiens | P68431 (AlphaFold model) |
| Histone H4 | N, R | protein | 102 | Homo sapiens | P62805 (AlphaFold model) |
| Histone H2A | O | protein | 129 | Homo sapiens | Q93077 (AlphaFold model) |
| Histone H2B | P | protein | 125 | Homo sapiens | P62807 (AlphaFold model) |
Sequence of entity 1 (K), FASTA
>8OOA_1 DNA strand 1 (chains K)
CTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGCAAGCTCTAGCACCGCTTAA
ACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCA
GGCACGTGTCAGATATATACATCCTGTGCATGTATTGAACAGCGACCTTGCCGGTGCCAG
TCGGATAGTGTTCCGAGCTCCCACTCTAGAGGATCCCCGGGTACCG
Sequence of entity 2 (L), FASTA
>8OOA_2 DNA Strand 2 (chains L)
CGGTACCCGGGGATCCTCTAGAGTGGGAGCTCGGAACACTATCCGACTGGCACCGGCAAG
GTCGCTGTTCAATACATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAG
TAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAG
AGCTTGCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAG
Sequence of entity 3 (M, Q), FASTA
>8OOA_3 Histone H3.1 (chains M, Q)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA
Sequence of entity 4 (N, R), FASTA
>8OOA_4 Histone H4 (chains N, R)
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 5 (O), FASTA
>8OOA_5 Histone H2A (chains O)
SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKT
ESHHKAKGK
Sequence of entity 6 (P), FASTA
>8OOA_6 Histone H2B (chains P)
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMG
IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSSK
Primary citation
Hexasome-INO80 complex reveals structural basis of noncanonical nucleosome remodeling. Zhang, M., Jungblut, A., Kunert, F. et al. Science (2023) 381:313-319. DOI 10.1126/science.adf6287 · PubMed
Other PDB entries of the same protein (UniProt P68431 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5SVY 1.05 Å, MORC3 CW in complex with histone H3K4me1
- 2V89 1.1 Å, Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution
- 5SZC 1.19 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
- 5SZB 1.2 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
- 6BHD 1.25 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 4UP0 1.28 Å, Ternary crystal structure of the Pygo2 PHD finger in complex with the B9L HD1 domain and…
- 5WXH 1.3 Å, Crystal structure of TAF3 PHD finger bound to H3K4me3
- 5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
- 4L7X 1.35 Å, Crystal structure of the DIDO PHD finger in complex with H3K4me3
- 6BHE 1.35 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 6BHI 1.4 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
Browse structure collections
About this viewer
MolViewer shows 8OOA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.