8P0Z: Transferrin receptor protein 1, serum form

AP01-S2.3 - a variant of a redesigned transferrin receptor apical domain. Determined by X-ray diffraction at 1.88 Å resolution. Released 27 Sept 2023.

Method: X-ray diffraction
Resolution: 1.88 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,377
Mol. weight: 18.29 kDa
Ligands: BO3
Released: 27 Sept 2023

Explore 8P0Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8P0Z contains 6 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
β-strand	15-19	5	1
β-strand	26	1	2
β-strand	31-35	5	1
β-strand	37-39	3	3
α-helix	45-50	6
β-strand	59-63	5	3
β-strand	65	1	4
β-strand	67	1	4
α-helix	69-78	10
β-strand	83-87	5	3
α-helix	94-95	2
β-strand	99	1	2
β-strand	112-114	3	3
α-helix	117-125	9
β-strand	127-130	4	3
α-helix	131-132	2
α-helix	133-135	3
β-strand	142-145	4	3
β-strand	149-155	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transferrin receptor protein 1, serum form	A	protein	168	Homo sapiens	P02786 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8P0Z_1 Transferrin receptor protein 1, serum form (chains A)
MQNSVIIVDKNGRLEYLVENPGGSVANSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIV
IVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFTGKGKSGIPVQTISREAA
EKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVGGRGSLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
BO3	Boric acid	B H3 O3	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Affinity Maturated Transferrin Receptor Apical Domain Blocks Machupo Virus Glycoprotein Binding. Sjostrom, D.J., Grill, B., Ambrosetti, E. et al. J Mol Biol (2023) 435:168262-168262. DOI 10.1016/j.jmb.2023.168262 · PubMed

Other PDB entries of the same protein (UniProt P02786 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OKD 1.85 Å, Crystal Structure of human transferrin receptor in complex with a cystine-dense peptide
6Y76 1.98 Å, AP01 - a redesigned transferrin receptor apical domain
9GH7 2.08 Å, Complex of human TfR1 with a potent bicyclic peptide
11QC 2.4 Å, Human transferrin receptor ectodomain
11RN 2.4 Å, Complex of B19V VP1u RBD and human transferrin receptor ectodomain
3KAS 2.4 Å, Machupo virus GP1 bound to human transferrin receptor 1
6WRV 2.47 Å, Crystal structure of computationally designed protein 3DS18 in complex with the human…
7ZQS 2.54 Å, Cryo-EM Structure of Human Transferrin Receptor 1 bound to DNA Aptamer
1DE4 2.8 Å, Hemochromatosis protein hfe complexed with transferrin receptor
6WRW 2.84 Å, Crystal structure of computationally designed protein 2DS25.5 in complex with the human…
6WRX 3.07 Å, Crystal structure of computationally designed protein 2DS25.1 in complex with the human…
1CX8 3.2 Å, Crystal structure of the ectodomain of human transferrin receptor

Browse structure collections

About this viewer

MolViewer shows 8P0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.