8P11: Acetylcholine-binding protein

Name: PDB 8P11: X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL003044.
Published: 2024-05-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: choline-binding protein

X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL003044. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 May 2024.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Lymnaea stagnalis
Chains: 10
Atoms: 16,962
Mol. weight: 271.9 kDa
Ligands: WD5
Released: 8 May 2024

Explore 8P11 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8P11 contains 42 α-helices and 150 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, H, I and J: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	22-32	11
β-strand	41	1	1
β-strand	44	1	1
α-helix	45	1
β-strand	46-61	16	2
β-strand	66-78	13	2
α-helix	80-82	3
β-strand	92-96	5	2
α-helix	97-99	3
β-strand	105-107	3	3
β-strand	110	1	2
β-strand	115-116	2	2
β-strand	121-125	5	2
β-strand	129-132	4	2
β-strand	135-141	7	2
β-strand	153-161	9	3
β-strand	169-172	4	2
β-strand	190-203	14	3
β-strand	210-222	13	3

Chain G: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	22-32	11
β-strand	41	1	19
β-strand	44	1	19
α-helix	45	1
β-strand	46-61	16	20
β-strand	66-78	13	20
α-helix	80-82	3
β-strand	92-96	5	20
α-helix	97-99	3
β-strand	105-107	3	21
β-strand	110	1	20
β-strand	115-116	2	20
β-strand	121-125	5	20
β-strand	129-132	4	20
β-strand	135-141	7	20
β-strand	153-161	9	21
β-strand	169-172	4	20
α-helix	173-175	3
β-strand	190-203	14	21
β-strand	210-222	13	21
α-helix	223-224	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acetylcholine-binding protein	A, B, C, D, E, F, G, H, I, J	protein	237	Lymnaea stagnalis	P58154 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>8P11_1 Acetylcholine-binding protein (chains A, B, C, D, E, F, G, H, I, J)
MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEV
NEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQ
LARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDD
SEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEILGSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
WD5	4-(4-chlorophenyl)piperidin-4-ol	C11 H14 Cl N O	4

Water and common crystallization additives (GOL, CL) are not listed.

Primary citation

Detection and characterisation of ligand-induced conformational changes in acetylcholine binding proteins using biosensors and X-ray crystallography. FitzGerald, E.A., Cederfelt, D., Kovryzhenko, D. et al. RSC Chem Biol (2025) 6:1625-1639. DOI 10.1039/d5cb00041f · PubMed

Other PDB entries of the same protein (UniProt P58154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDV 1.7 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001888.
4ZK1 1.75 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine-Binding Protein (LsAChBP) in…
4ZJT 1.85 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (LsAChBP) in…
4ZRU 1.9 Å, X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (Ls-AChBP) in…
7NDP 2.0 Å, X-ray structure of acetylcholine-binding protein (AChBP) in complex with FL001856.
7PD6 2.0 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
7PE6 2.01 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…
5J5G 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
5J5F 2.04 Å, X-Ray Crystal Structure of Acetylcholine Binding Protein (AChBP) in Complex with…
3WTN 2.09 Å, Crystal Structure of Lymnaea stagnalis Acetylcholine Binding Protein Complexed with…
4QAC 2.1 Å, X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH…
7PE5 2.1 Å, Crystal structure of Lymnaea stagnalis Acetylcholine-binding protein (Ls-AChBP)…

Browse structure collections

About this viewer

MolViewer shows 8P11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.