8P25: Chimeric U2AF2 RRM2 / FUBP1 N-Box

Name: PDB 8P25: Solution structure of a chimeric U2AF2 RRM2 / FUBP1 N-Box
Published: 2023-07-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: splicing

Solution structure of a chimeric U2AF2 RRM2 / FUBP1 N-Box. Determined by solution NMR. Released 26 Jul 2023.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,144
Mol. weight: 16.3 kDa
Released: 26 Jul 2023

Explore 8P25 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8P25 contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	251	1	1
β-strand	260-264	5	1
α-helix	272-279	8
β-strand	285-292	8	1
β-strand	299-307	9	1
α-helix	312-320	9
β-strand	323-325	3	2
β-strand	328-330	3	2
β-strand	331-334	4	1
α-helix	363-377	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor U2AF 65 kDa subunit,Far upstream element-binding protein 1	A	protein	160	Homo sapiens	P26368 (AlphaFold model), Q96AE4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8P25_1 Splicing factor U2AF 65 kDa subunit,Far upstream element-binding protein 1 (chains A)
AMDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAF
NLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNAGSGGSG
SSGSGGSGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSN

Primary citation

FUBP1 is a general splicing factor facilitating 3' splice site recognition and splicing of long introns. Ebersberger, S., Hipp, C., Mulorz, M.M. et al. Mol Cell (2023) 83:2653. DOI 10.1016/j.molcel.2023.07.002 · PubMed

Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0G 1.07 Å, Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
5W0H 1.11 Å, Structure of U2AF65 (U2AF2) RRM2 at 1.11 Angstrom Resolution
6XLV 1.4 Å, Crystal structure of leukemia-associated N196K mutant of U2AF65 bound to AdML splice site
9C7A 1.4 Å, Crystal structure of R149W neurodevelopmental disease-associated U2AF2 variant
9C7B 1.4 Å, Crystal structure of R150H neurodevelopmental disease-associated U2AF2 variant
2HZC 1.47 Å, Crystal structure of the N-terminal RRM of the U2AF large subunit
7S3A 1.48 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-C5 oligonucleotide
5EV3 1.5 Å, Structure III of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLW 1.5 Å, Crystal structure of U2AF65 bound to AdML splice site sequence
7S3C 1.51 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-A5 oligonucleotide
5EV4 1.57 Å, Structure IV of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLX 1.7 Å, Crystal structure of cancer-associated G301D mutant of U2AF65 bound to AdML splice site

Browse structure collections

About this viewer

MolViewer shows 8P25 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.