c-KIT kinase domain in complex with avapritinib derivative 12. Determined by X-ray diffraction at 1.9 Å resolution. Released 27 Dec 2023.
Explore 8PQF in 3D Show helices and sheets RCSB PDB PDBe
8PQF contains 36 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 573-575 | 3 | |
| α-helix | 577-578 | 2 | |
| α-helix | 580-582 | 3 | |
| β-strand | 583 | 1 | 1 |
| α-helix | 586-588 | 3 | |
| β-strand | 589-597 | 9 | 1 |
| β-strand | 601-609 | 9 | 1 |
| β-strand | 617-625 | 9 | 1 |
| α-helix | 631-647 | 17 | |
| β-strand | 653 | 1 | 2 |
| β-strand | 656-660 | 5 | 1 |
| β-strand | 667-671 | 5 | 1 |
| β-strand | 677 | 1 | 2 |
| α-helix | 678-685 | 8 | |
| α-helix | 766-785 | 20 | |
| β-strand | 788-789 | 2 | 3 |
| α-helix | 795-797 | 3 | |
| β-strand | 798-801 | 4 | 2 |
| β-strand | 805-808 | 4 | 2 |
| β-strand | 815-816 | 2 | 3 |
| β-strand | 823-824 | 2 | 4 |
| α-helix | 833-835 | 3 | |
| α-helix | 838-843 | 6 | |
| β-strand | 845-846 | 2 | 4 |
| α-helix | 848-863 | 16 | |
| α-helix | 867-868 | 2 | |
| α-helix | 877-884 | 8 | |
| α-helix | 897-906 | 10 | |
| α-helix | 911-913 | 3 | |
| α-helix | 915-916 | 2 | |
| α-helix | 917-929 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 573-575 | 3 | |
| α-helix | 577-579 | 3 | |
| α-helix | 580-582 | 3 | |
| β-strand | 583 | 1 | 5 |
| α-helix | 586-588 | 3 | |
| β-strand | 589-597 | 9 | 5 |
| β-strand | 601-609 | 9 | 5 |
| β-strand | 617-625 | 9 | 5 |
| α-helix | 631-647 | 17 | |
| β-strand | 653 | 1 | 6 |
| β-strand | 656-660 | 5 | 5 |
| β-strand | 667-671 | 5 | 5 |
| β-strand | 677 | 1 | 6 |
| α-helix | 678-685 | 8 | |
| α-helix | 766-785 | 20 | |
| β-strand | 788-789 | 2 | 7 |
| α-helix | 795-797 | 3 | |
| β-strand | 798-801 | 4 | 6 |
| α-helix | 802-804 | 3 | |
| β-strand | 805-808 | 4 | 6 |
| β-strand | 815-816 | 2 | 7 |
| β-strand | 823-824 | 2 | 8 |
| α-helix | 833-835 | 3 | |
| α-helix | 838-843 | 6 | |
| β-strand | 845-846 | 2 | 8 |
| α-helix | 848-863 | 16 | |
| α-helix | 867-868 | 2 | |
| α-helix | 877-885 | 9 | |
| α-helix | 889-892 | 4 | |
| α-helix | 897-906 | 10 | |
| α-helix | 911-913 | 3 | |
| α-helix | 915-916 | 2 | |
| α-helix | 917-931 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mast/stem cell growth factor receptor Kit | A, C | protein | 327 | Homo sapiens | P10721 (AlphaFold model) |
>8PQF_1 Mast/stem cell growth factor receptor Kit (chains A, C) GSMPMYEVQWKVVEESNGNNYSYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEAT AQGLIKSDAAMTVAVKMLKPSAHSTEREALMSELKVLSYLGNHENIVNLLGACTHGGPTL VITEYCCYGDLLNFLRRKRDEFVPYKVAPEDLYKDFLTLEHLLSFSYQVAKGMAFLASKN CIHRDLAARNILLTHGNITKICDFGLARDIKNDSNYVDKGNARLPVKWMAPESIFNSVYT FESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMSSPEYAPAEMYDIMKTCW DADPDKRPTFKQIVQDIEKQISESTNH
| ID | Name | Formula | Copies |
|---|---|---|---|
| 9KI | methyl ~{N}-[(1~{S})-1-(4-fluorophenyl)-1-[2-[4-[6-(1-methylpyrazol-4-yl)pyrrol… | C28 H29 F N10 O2 | 2 |
Avapritinib-based SAR studies unveil a binding pocket in KIT and PDGFRA. Teuber, A., Schulz, T., Fletcher, B.S. et al. Nat Commun (2024) 15:63-63. DOI 10.1038/s41467-023-44376-8 · PubMed
Other PDB entries of the same protein (UniProt P10721 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8PQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.