8Q1S: 14-3-3 protein epsilon

Pathogenic mutations of human phosphorylation sites affect protein-protein interactions. Determined by X-ray diffraction at 3.23 Å resolution. Released 21 Feb 2024.

Method: X-ray diffraction
Resolution: 3.23 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,935
Mol. weight: 62.22 kDa
Released: 21 Feb 2024

Explore 8Q1S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Q1S contains 27 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	20-32	13
α-helix	36-38	3
α-helix	39-73	35
α-helix	76-103	28
α-helix	104-108	5
α-helix	109-111	3
α-helix	115-135	21
α-helix	138-161	24
α-helix	168-183	16
α-helix	188-203	16
α-helix	214-231	18

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	20-32	13
α-helix	36-38	3
α-helix	39-73	35
α-helix	76-103	28
α-helix	104-108	5
α-helix	109-111	3
α-helix	115-135	21
α-helix	139-162	24
α-helix	168-183	16
α-helix	188-204	17
α-helix	206-208	3
α-helix	211-234	24

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	102-105	4

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	101-103	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein epsilon	A, B	protein	255	Homo sapiens	P62258 (AlphaFold model)
GATA zinc finger domain-containing protein 1	C, P	protein	15	Homo sapiens	Q8WUU5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8Q1S_1 14-3-3 protein epsilon (chains A, B)
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ

Sequence of entity 2 (C, P), FASTA

>8Q1S_2 GATA zinc finger domain-containing protein 1 (chains C, P)
LRNTKYKSAPAAEKK

Primary citation

Pathogenic mutations of human phosphorylation sites affect protein-protein interactions. Rrustemi, T., Meyer, K., Roske, Y. et al. Nat Commun (2024) 15:3146-3146. DOI 10.1038/s41467-024-46794-8 · PubMed

Other PDB entries of the same protein (UniProt P62258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BR9 1.75 Å, 14-3-3 Protein Epsilon (Human) Complexed to Peptide
3UAL 1.8 Å, Crystal Structure of 14-3-3 epsilon with Mlf1 peptide
7V9B 1.85 Å, Crystal Structure of 14-3-3 epsilon with FOXO3a peptide
3UBW 1.9 Å, Complex of 14-3-3 isoform epsilon, a Mlf1 phosphopeptide and a small fragment hit from a…
29II 2.17 Å, Structure of 14-3-3 epsilon in complex with a peptide derived from AMPK gamma 2
6EIH 2.7 Å, The crystal structure of 14-3-3 epsilon in complex with the phosphorylated NELFE peptide
8DGP 2.7 Å, 14-3-3 epsilon bound to phosphorylated PEAK3 (pS69) peptide
8DP5 3.1 Å, Structure of the PEAK3/14-3-3 complex
7C8E 3.16 Å, Crystal Structure of 14-3-3 epsilon with 9J10 peptide
8DGN 3.16 Å, 14-3-3 epsilon bound to phosphorylated PEAK2 (pS826) peptide
8DGM 3.2 Å, 14-3-3 epsilon bound to phosphorylated PEAK1 (pT1165) peptide

Browse structure collections

About this viewer

MolViewer shows 8Q1S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.