Structure of the lysine methyltransferase SETD2 in complex with a peptide derived from human tyrosine kinase ACK1. Determined by X-ray diffraction at 1.81 Å resolution. Released 24 Apr 2024.
Explore 8Q5P in 3D Show helices and sheets RCSB PDB PDBe
8Q5P contains 16 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1448-1450 | 3 | 1 |
| α-helix | 1451-1454 | 4 | |
| α-helix | 1457-1465 | 9 | |
| α-helix | 1470-1472 | 3 | |
| β-strand | 1474-1475 | 2 | 2 |
| β-strand | 1480-1481 | 2 | 3 |
| α-helix | 1501-1505 | 5 | |
| α-helix | 1506-1511 | 6 | |
| α-helix | 1513-1514 | 2 | |
| α-helix | 1521-1524 | 4 | |
| β-strand | 1527 | 1 | 4 |
| α-helix | 1536-1538 | 3 | |
| α-helix | 1543-1546 | 4 | |
| β-strand | 1552-1556 | 5 | 1 |
| β-strand | 1562-1566 | 5 | 1 |
| β-strand | 1570 | 1 | 5 |
| β-strand | 1575-1578 | 4 | 4 |
| β-strand | 1582-1584 | 3 | 3 |
| α-helix | 1586-1599 | 14 | |
| β-strand | 1606-1610 | 5 | 3 |
| β-strand | 1613-1616 | 4 | 3 |
| β-strand | 1620-1621 | 2 | 2 |
| α-helix | 1623-1626 | 4 | |
| α-helix | 1627 | 1 | |
| β-strand | 1628-1629 | 2 | 4 |
| β-strand | 1635-1642 | 8 | 4 |
| β-strand | 1645-1652 | 8 | 4 |
| β-strand | 1656 | 1 | 5 |
| α-helix | 1660 | 1 | |
| β-strand | 1661-1662 | 2 | 1 |
| β-strand | 1663-1664 | 2 | 4 |
| β-strand | 1669-1670 | 2 | 6 |
| α-helix | 1675 | 1 | |
| β-strand | 1676-1677 | 2 | 7 |
| α-helix | 1678 | 1 | |
| β-strand | 1688-1689 | 2 | 7 |
| α-helix | 1697-1700 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 34-35 | 2 | 6 |
| β-strand | 36 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase SETD2 | A | protein | 295 | Homo sapiens | Q9BYW2 (AlphaFold model) |
| Activated CDC42 kinase 1 | B | protein | 12 | Homo sapiens | Q07912 (AlphaFold model) |
>8Q5P_1 Histone-lysine N-methyltransferase SETD2 (chains A) MHHHHHHSSGRENLYFQGETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLI EENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNG DYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEY ARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLV PSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRK
>8Q5P_2 Activated CDC42 kinase 1 (chains B) QHLGGVMKPTYD
Structural and enzymatic evidence for the methylation of the ACK1 tyrosine kinase by the histone lysine methyltransferase SETD2. Le Coadou, L., Berthelet, J., Mechaly, A.E. et al. Biochem Biophys Res Commun (2024) 695:149400-149400. DOI 10.1016/j.bbrc.2023.149400 · PubMed
Other PDB entries of the same protein (UniProt Q9BYW2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8Q5P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.