Structure of human PAD6 Phosphomimic mutant V10E/S446E, apo. Determined by X-ray diffraction at 1.68 Å resolution. Released 8 May 2024.
Explore 8QL0 in 3D Show helices and sheets RCSB PDB PDBe
8QL0 contains 29 α-helices and 51 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-10 | 2 | 1 |
| β-strand | 14-16 | 3 | 2 |
| α-helix | 22 | 1 | |
| β-strand | 23-28 | 6 | 1 |
| β-strand | 33-36 | 4 | 2 |
| β-strand | 47-52 | 6 | 1 |
| β-strand | 56-59 | 4 | 2 |
| β-strand | 74-76 | 3 | 1 |
| β-strand | 82-87 | 6 | 2 |
| β-strand | 97-104 | 8 | 1 |
| β-strand | 113-122 | 10 | 1 |
| β-strand | 123-127 | 5 | 3 |
| α-helix | 144-146 | 3 | |
| β-strand | 149 | 1 | 4 |
| β-strand | 155 | 1 | 4 |
| β-strand | 157-159 | 3 | 5 |
| β-strand | 161 | 1 | 3 |
| α-helix | 165-167 | 3 | |
| β-strand | 178-180 | 3 | 3 |
| α-helix | 186-188 | 3 | |
| β-strand | 190-197 | 8 | 3 |
| α-helix | 200-203 | 4 | |
| β-strand | 206-211 | 6 | 5 |
| α-helix | 214-217 | 4 | |
| β-strand | 220-225 | 6 | 3 |
| β-strand | 232-237 | 6 | 3 |
| β-strand | 238 | 1 | 6 |
| β-strand | 241 | 1 | 6 |
| β-strand | 243-247 | 5 | 5 |
| β-strand | 252-261 | 10 | 3 |
| β-strand | 272-281 | 10 | 5 |
| α-helix | 289-290 | 2 | |
| β-strand | 291-302 | 12 | 5 |
| α-helix | 303-304 | 2 | |
| β-strand | 306-307 | 2 | 7 |
| α-helix | 313 | 1 | |
| β-strand | 314-320 | 7 | 8 |
| α-helix | 328-338 | 11 | |
| β-strand | 342-346 | 5 | 8 |
| α-helix | 356-359 | 4 | |
| β-strand | 361-368 | 8 | 7 |
| β-strand | 371-378 | 8 | 7 |
| α-helix | 389-392 | 4 | |
| α-helix | 394-395 | 2 | |
| β-strand | 399-402 | 4 | 7 |
| β-strand | 419-421 | 3 | 9 |
| α-helix | 422-424 | 3 | |
| β-strand | 425-427 | 3 | 10 |
| β-strand | 430-432 | 3 | 10 |
| β-strand | 437-441 | 5 | 9 |
| α-helix | 454-462 | 9 | |
| β-strand | 469-472 | 4 | 9 |
| β-strand | 476 | 1 | 11 |
| α-helix | 481-483 | 3 | |
| β-strand | 485-489 | 5 | 12 |
| β-strand | 500-506 | 7 | 12 |
| α-helix | 507-517 | 11 | |
| α-helix | 518-522 | 5 | |
| β-strand | 526-527 | 2 | 13 |
| α-helix | 533-538 | 6 | |
| β-strand | 544-545 | 2 | 13 |
| α-helix | 546-550 | 5 | |
| α-helix | 553-577 | 25 | |
| α-helix | 581-583 | 3 | |
| β-strand | 584-588 | 5 | 12 |
| β-strand | 591-594 | 4 | 11 |
| β-strand | 609-612 | 4 | 11 |
| β-strand | 621-623 | 3 | 14 |
| β-strand | 626-630 | 5 | 14 |
| α-helix | 631 | 1 | |
| β-strand | 636-637 | 2 | 15 |
| β-strand | 640-641 | 2 | 15 |
| α-helix | 642-651 | 10 | |
| α-helix | 652-654 | 3 | |
| β-strand | 657-661 | 5 | 14 |
| α-helix | 664-667 | 4 | |
| α-helix | 669-670 | 2 | |
| β-strand | 677-682 | 6 | 8 |
| α-helix | 683-685 | 3 | |
| α-helix | 689-691 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein-arginine deiminase type-6 | A | protein | 693 | Homo sapiens | Q6TGC4 (AlphaFold model) |
>8QL0_1 Protein-arginine deiminase type-6 (chains A) VSVEGRAMEFQSIIHLSLDSPVHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLIDVA NTVISEKEDATIWWPLSDPTYATVKMTSPSPSVDADKVSVTYYGPNEDAPVGTAVLYLTG IEVSLEVDIYRNGQVEMSSDKQAKKKWIWGPSGWGAILLVNCNPADVGQQLEDKKTKKVI FSEEITNLSQMTLNVQGPSCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPDQ HAYTLALLGNHLKETFYVEAIAFPSAEFSGLISYSVSLVEESQDPSIPETVLYKDTVVFR VAPCVFIPCTQVPLEVYLCRELQLQGFVDTVTKLSEKSNSQVASVYEDPNRLGRWLQDEM AFCYTQAPHKTTSLILDTPQAADLDEFPMKYSLSPGIGYMIQDTEDHKVASMDSIGNLMV SPPVKVQGKEYPLGRVLIGSSFYPEAEGRAMSKTLRDFLYAQQVQAPVELYSDWLMTGHV DEFMCFIPTDDKNEGKKGFLLLLASPSACYKLFREKQKEGYGDALLFDELRADQLLSNGR EAKTIDQLLADESLKKQNEYVEKCIHLNRDILKTELGLVEQDIIEIPQLFCLEKLTNIPS DQQPKRSFARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLEPLGFKCTFI NDFDCYLTEVGDICACANIRRVPFAFKWWKMVP
Crystal structure of human peptidylarginine deiminase type VI (PAD6) provides insights into its inactivity. Ranaivoson, F.M., Bande, R., Cardaun, I. et al. IUCrJ (2024) 11:395-404. DOI 10.1107/S2052252524002549 · PubMed
Other PDB entries of the same protein (UniProt Q6TGC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8QL0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.