Xylanase from Bacillus circulans mutant E78Q bound to xylotriose. Determined by X-ray diffraction at 1.41 Å resolution. Released 21 Aug 2024.
Explore 8QXY in 3D Show helices and sheets RCSB PDB PDBe
8QXY contains 6 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 15-20 | 6 | 1 |
| β-strand | 25-31 | 7 | 1 |
| β-strand | 35-42 | 8 | 1 |
| β-strand | 50-73 | 24 | 1 |
| β-strand | 77-85 | 9 | 1 |
| β-strand | 93-100 | 8 | 1 |
| β-strand | 103-117 | 15 | 1 |
| β-strand | 120-132 | 13 | 1 |
| α-helix | 135-137 | 3 | |
| β-strand | 142-145 | 4 | 1 |
| α-helix | 146-155 | 10 | |
| α-helix | 159-161 | 3 | |
| β-strand | 163-184 | 22 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endo-1,4-beta-xylanase | A, B | protein | 185 | Niallia circulans subsp. circulans | P09850 (AlphaFold model) |
>8QXY_1 Endo-1,4-beta-xylanase (chains A, B) ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAP NGNGYLTLYGWTRSPLIQYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG DRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSS NVTVW
| ID | Name | Formula | Copies |
|---|---|---|---|
| BTB | 2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol | C8 H19 N O5 | 2 |
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (GOL) are not listed.
Bimodal substrate binding in the active site of the glycosidase BcX. Saberi, M., Chikunova, A., Ben Bdira, F. et al. FEBS J (2024) 291:4222-4239. DOI 10.1111/febs.17251 · PubMed
Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8QXY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.