8QXZ: Endo-1,4-beta-xylanase

Xylanase from Bacillus circulans mutant E78Q/Y69A. Determined by X-ray diffraction at 1.5 Å resolution. Released 21 Aug 2024.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Niallia circulans subsp. circulans
Chains: 2
Atoms: 3,328
Mol. weight: 41.47 kDa
Ligands: BTB, ZN
Released: 21 Aug 2024

Explore 8QXZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QXZ contains 6 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	15-20	6	1
β-strand	25-31	7	1
β-strand	35-42	8	1
α-helix	49	1
β-strand	50-73	24	1
β-strand	77-85	9	1
β-strand	93-100	8	1
β-strand	103-117	15	1
β-strand	120-132	13	1
α-helix	135-137	3
β-strand	142-145	4	1
α-helix	146-155	10
β-strand	163-184	22	1

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	2
β-strand	15-20	6	2
β-strand	25-31	7	2
β-strand	35-42	8	2
β-strand	50-73	24	2
β-strand	77-85	9	2
β-strand	93-100	8	2
β-strand	103-117	15	2
β-strand	120-132	13	2
α-helix	135-137	3
β-strand	142-145	4	2
α-helix	146-155	10
α-helix	159-161	3
β-strand	163-184	22	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endo-1,4-beta-xylanase	A, B	protein	185	Niallia circulans subsp. circulans	P09850 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8QXZ_1 Endo-1,4-beta-xylanase (chains A, B)
ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAP
NGNGYLTLAGWTRSPLIQYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG
DRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSS
NVTVW

Ligands and cofactors

ID	Name	Formula	Copies
BTB	2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol	C8 H19 N O5	2
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL, PEG) are not listed.

Primary citation

Bimodal substrate binding in the active site of the glycosidase BcX. Saberi, M., Chikunova, A., Ben Bdira, F. et al. FEBS J (2024) 291:4222-4239. DOI 10.1111/febs.17251 · PubMed

Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QY3 1.24 Å, Xylanase from Bacillus circulans mutant E78Q/F125A bound to xylotriose
8R85 1.3 Å, Xylanase from Bacillus circulans mutant E78Q/W9A
8QXY 1.41 Å, Xylanase from Bacillus circulans mutant E78Q bound to xylotriose
1XNB 1.49 Å, High-resolution structures of xylanases from B. Circulans and T. Harzianum identify a…
2BVV 1.5 Å, Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase.
8R86 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/W71A
1C5H 1.55 Å, Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid…
3VZK 1.55 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant
1HV0 1.6 Å, Dissecting electrostatic interactions and the PH-dependent activity of a family 11…
1XNC 1.6 Å, Thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide…
3VZN 1.67 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant…
8QY2 1.7 Å, Xylanase from Bacillus circulans mutant E78Q/F125A

Browse structure collections

About this viewer

MolViewer shows 8QXZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.