8QYP: Myosin-7

Beta-cardiac myosin motor domain in the pre-powerstroke state. Determined by X-ray diffraction at 2.76 Å resolution. Released 13 Dec 2023.

Method: X-ray diffraction
Resolution: 2.76 Å
Organism: Bos taurus
Chains: 1
Atoms: 5,723
Mol. weight: 89.68 kDa
Ligands: MG, VO4, ADP
Released: 13 Dec 2023

Explore 8QYP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QYP contains 41 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 41 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	36-41	6	1
β-strand	45-51	7	1
β-strand	60-63	4	1
β-strand	68-70	3	1
α-helix	73-75	3
β-strand	77-78	2	1
α-helix	79-81	3
α-helix	82-84	3
β-strand	89	1	2
α-helix	90-92	3
α-helix	98-110	13
β-strand	115-118	4	2
β-strand	121-125	5	2
α-helix	136-142	7
α-helix	147-149	3
α-helix	154-164	11
α-helix	165-169	5
β-strand	172-177	6	2
α-helix	184-200	17
α-helix	216-231	16
β-strand	232-233	2	3
β-strand	241-242	2	3
β-strand	245-252	8	2
β-strand	258-266	9	2
α-helix	270-274	5
β-strand	283	1	3
α-helix	284-291	8
α-helix	295-300	6
α-helix	307-309	3
α-helix	325-338	14
α-helix	343-360	18
β-strand	364-366	3	4
β-strand	373-375	3	4
α-helix	379-388	10
α-helix	392-400	9
β-strand	403-406	4	5
β-strand	409-412	4	5
α-helix	417-447	31
β-strand	455-461	7	2
α-helix	462-465	4
β-strand	471	1	6
α-helix	473-490	18
α-helix	491-496	6
α-helix	497-503	7
α-helix	518-525	8
α-helix	530-537	8
α-helix	545-556	12
β-strand	563-564	2	6
α-helix	568-569	2
α-helix	573-574	2
β-strand	577-581	5	6
β-strand	584-588	5	6
α-helix	593-598	6
α-helix	603-610	8
α-helix	615-620	6
α-helix	647-663	17
β-strand	666-673	8	2
α-helix	686-696	11
α-helix	698-707	10
β-strand	711-714	4	7
α-helix	715-722	8
α-helix	723-725	3
α-helix	727-729	3
α-helix	738-748	11
β-strand	756-758	3	7
β-strand	762-765	4	7
α-helix	766	1
α-helix	769-778	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-7	A	protein	780	Bos taurus	Q9BE39 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8QYP_1 Myosin-7 (chains A)
MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKATILSREGGKVT
AETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL
FCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKEQATGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTTEEKNSMYKLTGAIMHFG
NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
VYAKGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNIIGWLQKNKDP
LNETVVDLYKKSSLKMLSSLFANYAGFDTPIEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
VO4	Vanadate ion	O4 V	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

Omecamtiv mecarbil and Mavacamten target the same myosin pocket despite antagonistic effects in heart contraction. Auguin, D., Robert-Paganin, J., Rety, S. et al. bioRxiv (2023). DOI 10.1101/2023.11.15.567213 · PubMed

Other PDB entries of the same protein (UniProt Q9BE39 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QYR 1.8 Å, Beta-cardiac myosin motor domain in the pre-powerstroke state complexed to Mavacamten
8QYU 1.96 Å, Beta-cardiac myosin S1 fragment in the pre-powerstroke state complexed to Omecamtiv…
6FSA 2.33 Å, Beta-Cardiac myosin post-rigor
9F6C 2.33 Å, Cardiac myosin motor domain in the pre-powerstroke state co-crystallized with the…
5N69 2.45 Å, Cardiac muscle myosin S1 fragment in the pre-powerstroke state co-crystallized with the…
8QYQ 2.61 Å, Beta-cardiac myosin S1 fragment in the pre-powerstroke state complexed to Mavacamten
5N6A 3.1 Å, Cardiac muscle myosin motor domain in the pre-powerstroke state
6X5Z 4.24 Å, Bovine Cardiac Myosin in Complex with Chicken Skeletal Actin and Human Cardiac…

Browse structure collections

About this viewer

MolViewer shows 8QYP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.