8R85: Xylanase from Bacillus circulans mutant E78Q/W9A

Xylanase from Bacillus circulans mutant E78Q/W9A. Determined by X-ray diffraction at 1.3 Å resolution. Released 21 Aug 2024.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Niallia circulans subsp. circulans
Chains: 1
Atoms: 1,713
Mol. weight: 20.49 kDa
Released: 21 Aug 2024

Explore 8R85 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8R85 contains 2 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	15-20	6	2
β-strand	25-31	7	2
β-strand	35-42	8	1
β-strand	50-61	12	2
β-strand	64-73	10	1
β-strand	77-85	9	1
β-strand	93-100	8	1
β-strand	103-117	15	1
β-strand	120-132	13	1
α-helix	135-137	3
β-strand	142-145	4	2
α-helix	146-155	10
β-strand	163-174	12	1
β-strand	177-184	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endo-1,4-beta-xylanase	A	protein	185	Niallia circulans subsp. circulans	P09850 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8R85_1 Endo-1,4-beta-xylanase (chains A)
ASTDYWQNATDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAP
NGNGYLTLYGWTRSPLIQYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG
DRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSS
NVTVW

Primary citation

Bimodal substrate binding in the active site of the glycosidase BcX. Saberi, M., Chikunova, A., Ben Bdira, F. et al. FEBS J (2024) 291:4222-4239. DOI 10.1111/febs.17251 · PubMed

Other PDB entries of the same protein (UniProt P09850 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QY3 1.24 Å, Xylanase from Bacillus circulans mutant E78Q/F125A bound to xylotriose
8QXY 1.41 Å, Xylanase from Bacillus circulans mutant E78Q bound to xylotriose
1XNB 1.49 Å, High-resolution structures of xylanases from B. Circulans and T. Harzianum identify a…
2BVV 1.5 Å, Sugar ring distortion in the glycosyl-enzyme intermediate of a family G/11 xylanase.
8QXZ 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/Y69A
8R86 1.5 Å, Xylanase from Bacillus circulans mutant E78Q/W71A
1C5H 1.55 Å, Hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid…
3VZK 1.55 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant
1HV0 1.6 Å, Dissecting electrostatic interactions and the PH-dependent activity of a family 11…
1XNC 1.6 Å, Thermostabilization of the bacillus circulans xylanase, by the introduction of disulfide…
3VZN 1.67 Å, Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant…
8QY2 1.7 Å, Xylanase from Bacillus circulans mutant E78Q/F125A

Browse structure collections

About this viewer

MolViewer shows 8R85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.