8RCH: Serine/threonine-protein kinase mTOR

CryoEM structure of mTORC1 with a paediatric kidney cancer-associated 1455-EWED-1458 duplication in mTOR, overall refinement. Determined by electron microscopy at 4.0 Å resolution. Released 11 Sept 2024.

Method: Electron microscopy
Resolution: 4.0 Å
Organism: Homo sapiens
Chains: 8
Atoms: 49,608
Mol. weight: 975.03 kDa
Ligands: MG, ANP
Released: 11 Sept 2024

Explore 8RCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RCH contains 352 α-helices and 133 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 140 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	62-72	11
α-helix	83-90	8
α-helix	100-102	3
α-helix	103-107	5
α-helix	108-114	7
α-helix	120-134	15
α-helix	139-154	16
α-helix	168-176	9
α-helix	180-182	3
α-helix	188-197	10
α-helix	204-211	8
α-helix	214-220	7
α-helix	236-239	4
α-helix	240-244	5
α-helix	262-275	14
α-helix	278-287	10
α-helix	387-399	13
α-helix	411-422	12
α-helix	435-439	5
α-helix	448-450	3
α-helix	452-460	9
α-helix	479-488	10
α-helix	498-511	14
α-helix	515-527	13
α-helix	531-543	13
α-helix	544-548	5
α-helix	579-591	13
α-helix	601-611	11
α-helix	616-629	14
α-helix	646-665	20
α-helix	669-677	9
α-helix	681-683	3
α-helix	684-687	4
α-helix	690-699	10
α-helix	705-718	14
α-helix	723-743	21
α-helix	748-763	16
α-helix	772-784	13
α-helix	795-809	15
α-helix	810-816	7
α-helix	817-829	13
α-helix	831-833	3
α-helix	837-850	14
α-helix	857-860	4
α-helix	863-874	12
α-helix	878-891	14
α-helix	896-901	6
α-helix	934-938	5
α-helix	943-946	4
α-helix	948-959	12
α-helix	964-982	19
α-helix	983-988	6
α-helix	990-1003	14
α-helix	1006-1023	18
α-helix	1024-1030	7
α-helix	1031-1040	10
α-helix	1046-1062	17
α-helix	1067-1069	3
α-helix	1075-1082	8
α-helix	1091-1103	13
α-helix	1104-1109	6
α-helix	1111-1123	13
α-helix	1129-1133	5
α-helix	1137-1143	7
α-helix	1152-1163	12
α-helix	1167-1169	3
α-helix	1170-1184	15
α-helix	1185-1188	4
α-helix	1192-1199	8
α-helix	1207-1218	12
α-helix	1262-1269	8
α-helix	1270-1273	4
α-helix	1277-1293	17
α-helix	1298-1310	13
α-helix	1312-1328	17
α-helix	1331-1347	17
α-helix	1351-1366	16
α-helix	1376-1379	4
α-helix	1380-1389	10
α-helix	1393-1406	14
α-helix	1410-1422	13
α-helix	1426-1439	14
α-helix	1514-1520	7
α-helix	1529-1532	4
α-helix	1533-1535	3
α-helix	1541-1547	7
α-helix	1557-1578	22
α-helix	1586-1607	22
α-helix	1609-1625	17
α-helix	1630-1640	11
α-helix	1650-1658	9
α-helix	1666-1677	12
α-helix	1681-1684	4
α-helix	1694-1705	12
α-helix	1710-1730	21
α-helix	1737-1762	26
α-helix	1769-1782	14
α-helix	1787-1812	26
α-helix	1868-1893	26
α-helix	1899-1912	14
α-helix	1917-1926	10
α-helix	1927-1929	3
α-helix	1932-1935	4
α-helix	1936-1938	3
α-helix	1939-1943	5
α-helix	1951-1967	17
α-helix	1969-1980	12
α-helix	1985-2002	18
α-helix	2005-2020	16
α-helix	2023-2035	13
α-helix	2036-2041	6
α-helix	2044-2060	17
α-helix	2065-2070	6
α-helix	2071-2075	5
α-helix	2076-2091	16
α-helix	2094-2114	21
β-strand	2120-2122	3	1
α-helix	2123-2125	3
α-helix	2128-2131	4
β-strand	2136-2139	4	1
α-helix	2140	1
β-strand	2141	1	2
β-strand	2143	1	2
α-helix	2150-2151	2
β-strand	2152-2156	5	1
β-strand	2159-2162	4	1
α-helix	2163-2164	2
β-strand	2170-2176	7	1
β-strand	2181-2188	8	1
α-helix	2193-2210	18
α-helix	2213-2217	5
β-strand	2228-2230	3	1
β-strand	2234-2236	3	1
β-strand	2243-2245	3	3
α-helix	2246-2256	11
α-helix	2263-2271	9
α-helix	2275-2277	3
α-helix	2280-2292	13
α-helix	2298-2305	8
α-helix	2310-2334	25
α-helix	2341-2343	3
β-strand	2344-2347	4	3
β-strand	2353-2355	3	3
α-helix	2365-2367	3
α-helix	2381-2386	6
α-helix	2392-2396	5
α-helix	2397-2409	13
α-helix	2411-2423	13
α-helix	2425-2428	4
α-helix	2429-2433	5
α-helix	2493-2508	16
α-helix	2521-2532	12
α-helix	2535-2540	6

Chain B: 138 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	62-73	12
α-helix	83-91	9
α-helix	101-114	14
α-helix	120-134	15
α-helix	139-155	17
α-helix	168-175	8
α-helix	187-197	11
α-helix	204-211	8
α-helix	212-214	3
α-helix	218-222	5
α-helix	234-236	3
α-helix	238-243	6
α-helix	262-275	14
α-helix	278-286	9
α-helix	387-402	16
α-helix	411-421	11
α-helix	435-439	5
α-helix	449-454	6
α-helix	456-462	7
α-helix	480-489	10
α-helix	501-508	8
α-helix	517-527	11
α-helix	532-548	17
α-helix	579-591	13
α-helix	600-609	10
α-helix	616-629	14
α-helix	646-665	20
α-helix	669-677	9
α-helix	681-683	3
α-helix	684-688	5
α-helix	690-700	11
α-helix	705-718	14
α-helix	723-743	21
α-helix	748-763	16
α-helix	765-768	4
α-helix	772-784	13
α-helix	794-809	16
α-helix	810-815	6
α-helix	817-829	13
α-helix	831-833	3
α-helix	837-851	15
α-helix	857-860	4
α-helix	864-874	11
α-helix	878-891	14
β-strand	894	1	14
α-helix	896-902	7
α-helix	934-938	5
α-helix	943-960	18
α-helix	964-982	19
α-helix	983-989	7
α-helix	990-1003	14
α-helix	1006-1022	17
α-helix	1024-1026	3
α-helix	1031-1040	10
α-helix	1046-1062	17
α-helix	1066-1073	8
α-helix	1075-1084	10
α-helix	1088-1090	3
α-helix	1091-1100	10
α-helix	1104-1109	6
α-helix	1111-1123	13
α-helix	1129-1142	14
α-helix	1152-1165	14
α-helix	1167-1169	3
α-helix	1170-1184	15
α-helix	1185-1191	7
α-helix	1192-1201	10
α-helix	1207-1218	12
α-helix	1263-1268	6
α-helix	1269-1272	4
α-helix	1277-1293	17
α-helix	1298-1302	5
α-helix	1306-1308	3
α-helix	1312-1315	4
α-helix	1318-1328	11
α-helix	1331-1347	17
α-helix	1351-1366	16
α-helix	1376-1379	4
α-helix	1380-1389	10
α-helix	1393-1406	14
α-helix	1410-1422	13
α-helix	1426-1439	14
α-helix	1514-1520	7
α-helix	1529-1534	6
α-helix	1541-1545	5
α-helix	1557-1578	22
α-helix	1586-1607	22
α-helix	1612-1625	14
β-strand	1626	1	14
α-helix	1630-1641	12
α-helix	1650-1657	8
α-helix	1666-1677	12
α-helix	1681-1684	4
α-helix	1694-1705	12
α-helix	1710-1728	19
α-helix	1737-1757	21
α-helix	1758-1762	5
α-helix	1769-1782	14
α-helix	1788-1812	25
α-helix	1868-1876	9
α-helix	1878-1893	16
α-helix	1900-1912	13
α-helix	1917-1929	13
α-helix	1932-1935	4
α-helix	1936-1938	3
α-helix	1941-1944	4
α-helix	1951-1967	17
α-helix	1970-1980	11
α-helix	1985-2002	18
α-helix	2005-2018	14
α-helix	2023-2028	6
α-helix	2031-2041	11
α-helix	2044-2059	16
α-helix	2065-2070	6
α-helix	2071-2075	5
α-helix	2076-2091	16
α-helix	2094-2112	19
β-strand	2121-2122	2	15
α-helix	2123-2125	3
α-helix	2128-2131	4
α-helix	2138	1
β-strand	2139	1	16
α-helix	2140	1
α-helix	2149-2151	3
β-strand	2152	1	16
β-strand	2153-2156	4	17
β-strand	2159-2160	2	15
β-strand	2161-2162	2	17
β-strand	2170-2176	7	17
β-strand	2181-2188	8	17
α-helix	2193-2211	19
α-helix	2213-2217	5
β-strand	2227-2229	3	17
β-strand	2234-2238	5	17
β-strand	2244-2245	2	18
α-helix	2246-2256	11
α-helix	2263-2271	9
α-helix	2275-2277	3
α-helix	2280-2292	13
α-helix	2298-2305	8
α-helix	2310-2334	25
α-helix	2341-2343	3
β-strand	2344-2346	3	18
β-strand	2353-2355	3	18
α-helix	2363-2367	5
α-helix	2381-2386	6
α-helix	2395-2409	15
α-helix	2411-2422	12
α-helix	2429-2432	4
α-helix	2493-2507	15
α-helix	2521-2533	13
α-helix	2535-2539	5
α-helix	2541-2542	2

Chain D: 1 helix, 29 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	4
β-strand	23-28	6	4
β-strand	34-39	6	4
β-strand	47-50	4	5
β-strand	57-61	5	5
β-strand	64-68	5	5
β-strand	77	1	5
β-strand	93	1	6
β-strand	100-102	3	6
β-strand	104	1	7
β-strand	108-112	5	6
β-strand	123-126	4	6
β-strand	131-136	6	7
β-strand	143-147	5	7
β-strand	152-155	4	7
β-strand	162-165	4	7
β-strand	173-177	5	8
β-strand	185-189	5	8
β-strand	194-198	5	8
β-strand	211-216	6	8
β-strand	223-228	6	9
β-strand	234-239	6	9
β-strand	244-248	5	9
β-strand	253-258	6	9
α-helix	265-267	3
β-strand	276-278	3	10
β-strand	284-289	6	10
β-strand	293-298	6	10
β-strand	304-308	5	10
β-strand	319-320	2	4

Chain E: 2 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	14-19	6	19
β-strand	23-28	6	19
β-strand	34-39	6	19
β-strand	45-50	6	20
β-strand	56-61	6	20
β-strand	64-69	6	20
α-helix	75-76	2
β-strand	77-79	3	20
β-strand	100-102	3	21
β-strand	104	1	22
β-strand	108-112	5	21
β-strand	123-126	4	21
β-strand	131-136	6	22
β-strand	142-147	6	22
β-strand	152-156	5	22
β-strand	162-165	4	22
β-strand	173-178	6	23
β-strand	184-189	6	23
β-strand	194-199	6	23
β-strand	210-216	7	23
β-strand	223-227	5	24
β-strand	234-239	6	24
β-strand	243-248	6	24
β-strand	253-259	7	24
α-helix	265-267	3
β-strand	276-279	4	25
β-strand	284-288	5	25
β-strand	293-298	6	25
β-strand	304-309	6	25
β-strand	315-320	6	19

Chain W: 25 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	59-64	6	11
α-helix	70-72	3
α-helix	79-81	3
β-strand	85	1	12
β-strand	88	1	12
α-helix	90-92	3
α-helix	95-98	4
α-helix	100-111	12
β-strand	118-123	6	11
α-helix	128-140	13
β-strand	146-150	5	11
β-strand	164	1	13
β-strand	175	1	13
α-helix	179-185	7
β-strand	190-194	5	11
α-helix	199-218	20
β-strand	240-244	5	11
α-helix	251-253	3
α-helix	262-266	5
α-helix	270-281	12
α-helix	292-295	4
α-helix	308-327	20
α-helix	330-336	7
α-helix	341-357	17
β-strand	365-366	2	11
α-helix	373-375	3
α-helix	379-397	19
α-helix	401-406	6
α-helix	408-422	15
α-helix	429-430	2
α-helix	433-439	7
α-helix	443-456	14
α-helix	461-470	10
α-helix	472-479	8
α-helix	488-498	11

Chain Y: 46 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	19-22	4
α-helix	33-36	4
β-strand	57-64	8	26
β-strand	85	1	27
β-strand	88	1	27
α-helix	95-113	19
β-strand	118-123	6	26
α-helix	128-140	13
β-strand	145-150	6	26
α-helix	156-158	3
β-strand	164-167	4	28
β-strand	174-177	4	28
α-helix	179-185	7
β-strand	190-194	5	26
α-helix	199-218	20
β-strand	240-244	5	26
α-helix	262-268	7
α-helix	270-281	12
α-helix	292-295	4
α-helix	308-327	20
α-helix	330-337	8
α-helix	341-358	18
β-strand	365-366	2	26
α-helix	369-372	4
α-helix	378-392	15
α-helix	401-406	6
α-helix	408-420	13
α-helix	428-430	3
α-helix	433-439	7
α-helix	446-456	11
α-helix	461-470	10
α-helix	473-480	8
α-helix	485-487	3
α-helix	488-501	14
α-helix	508-511	4
α-helix	515-523	9
α-helix	529-545	17
α-helix	547-555	9
α-helix	558-565	8
α-helix	571-585	15
α-helix	589-597	9
α-helix	600-606	7
α-helix	607-609	3
α-helix	613-628	16
α-helix	637-649	13
α-helix	650-653	4
α-helix	657-685	29
α-helix	807-820	14
α-helix	824-839	16
α-helix	959-968	10
α-helix	970	1
α-helix	973-975	3
α-helix	976-978	3
α-helix	983-1007	25
β-strand	1015-1021	7	29
β-strand	1028-1030	3	30
β-strand	1038-1041	4	30
β-strand	1045-1049	5	30
β-strand	1056-1061	6	30
β-strand	1070-1075	6	31
α-helix	1082-1083	2
β-strand	1084-1088	5	31
β-strand	1092-1096	5	31
β-strand	1110-1113	4	31
β-strand	1128-1132	5	32
β-strand	1137-1141	5	32
β-strand	1147-1151	5	32
β-strand	1158-1161	4	32
β-strand	1173-1175	3	33
β-strand	1180-1183	4	33
β-strand	1190-1194	5	33
β-strand	1205-1207	3	33
β-strand	1214-1219	6	34
α-helix	1226	1
β-strand	1227-1231	5	34
β-strand	1236-1240	5	34
β-strand	1243-1249	7	34
β-strand	1260-1262	3	35
β-strand	1267-1271	5	35
β-strand	1277-1280	4	35
β-strand	1286-1290	5	35
β-strand	1304-1309	6	29
β-strand	1316-1320	5	29
β-strand	1324-1329	6	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase mTOR	A, B	protein	2549	Homo sapiens	P42345 (AlphaFold model)
Target of rapamycin complex subunit LST8	D, E	protein	326	Homo sapiens	Q9BVC4 (AlphaFold model)
Regulatory-associated protein of mTOR	W, Y	protein	1335	Homo sapiens	Q8N122 (AlphaFold model)
Eukaryotic translation initiation factor 4E-binding protein 1	X, Z	protein	118	Homo sapiens	Q13541 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8RCH_1 Serine/threonine-protein kinase mTOR (chains A, B)
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW

Sequence of entity 2 (D, E), FASTA

>8RCH_2 Target of rapamycin complex subunit LST8 (chains D, E)
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDP
DASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG

Sequence of entity 3 (W, Y), FASTA

>8RCH_3 Regulatory-associated protein of mTOR (chains W, Y)
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR

Sequence of entity 4 (X, Z), FASTA

>8RCH_4 Eukaryotic translation initiation factor 4E-binding protein 1 (chains X, Z)
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Primary citation

cryoEM structure of mTORC1 with the cancer-associated 1455-EWED-1458 duplication variant, overall refinement. Anandapadamanaban, M., Hay, I., Perisic, O. et al. To be published.

Other PDB entries of the same protein (UniProt P42345 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DRI 1.45 Å, Co-crystal structure of the PPIase domain of FKBP51, Rapamycin and the FRB fragment of…
9DBO 1.55 Å, Crystal structure of a synthetic Fab (R3E9) in complex with the FRB domain of mTOR
5GPG 1.67 Å, Co-crystal structure of the FK506 binding domain of human FKBP25, Rapamycin and the FRB…
5WBH 1.75 Å, Structure of the FRB domain of mTOR bound to a substrate recruitment peptide of S6K1
4DRJ 1.8 Å, o-crystal structure of the PPIase domain of FKBP52, Rapamycin and the FRB fragment of mTOR
3FAP 1.85 Å, Atomic structures of the rapamycin analogs in complex with both human FKBP12 and frb…
8PPZ 1.85 Å, Co-crystal structure of FKBP12, compound 7 and the FRB fragment of mTOR
8XI9 1.85 Å, Crystal structure of FRB-FKBP fusion protein in complex with rapamycin
9PIW 1.9 Å, Crystal structure of a synthetic Fab (1A) in complex with the FRB domain of mTOR
9DL0 2.0 Å, Crystal structure of a synthetic Fab (R3H8) in complex with the FRB domain of mTOR
9PJ1 2.05 Å, Crystal structure of a synthetic Fab (4R) in complex with the ternary assembly of…
9PIU 2.18 Å, Crystal structure of a synthetic Fab (2C) in complex with the FRB domain of mTOR

Browse structure collections

About this viewer

MolViewer shows 8RCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.