8RLM: TRIF Oligomerisation

TRIF Oligomerisation. Determined by electron microscopy at 3.5 Å resolution. Released 16 Jul 2025.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 6
Atoms: 7,434
Mol. weight: 465.55 kDa
Released: 16 Jul 2025

Explore 8RLM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RLM contains 60 α-helices and 30 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E and F: 10 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	395-400	6	1
α-helix	403-405	3
α-helix	406-419	14
β-strand	426	1	1
α-helix	427-430	4
α-helix	442-447	6
β-strand	449-455	7	1
α-helix	458-460	3
α-helix	463-478	16
β-strand	487-490	4	1
α-helix	496-498	3
α-helix	501-506	6
β-strand	513-514	2	1
α-helix	520-527	8
α-helix	530-553	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TIR domain-containing adapter molecule 1	A, B, C, D, E, F	protein	721	Homo sapiens	Q8IUC6 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>8RLM_1 TIR domain-containing adapter molecule 1 (chains A, B, C, D, E, F)
SNAMACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEA
RISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVA
YQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRS
LPRPIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQAS
LVPEPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETS
TNYPVECTEGSAGPQSLPLPILEPVENPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPE
TSPPPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLE
ALGVPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNL
TRQGSPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARK
AMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSF
GTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPF
PQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAEHHHHH
H

Primary citation

Toll-like receptor signaling outcome is determined by the stoichiometry of the endogenous TRIFosome. Moncrieffe, M.C., Suresh, P., Boyle, J. et al. Sci Adv (2026) 12:eaeb9507-eaeb9507. DOI 10.1126/sciadv.aeb9507 · PubMed

Other PDB entries of the same protein (UniProt Q8IUC6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RC4 1.5 Å, Molecular mechanisms of viral and host-cell substrate recognition by HCV NS3/4A protease
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
4BSX 2.23 Å, Crystal Structure of the N terminal domain of TRIF (TIR-domain- containing…
4C0M 2.8 Å, Crystal Structure of the N terminal domain of wild type TRIF (TIR- domain-containing…
9DK8 3.3 Å, TRIF TIR Filament Cryo-EM Structure
2M1X TICAM-1 TIR domain structure
2M63 The protease-resistant N-terminal domain of TIR-domain containing adaptor molecule-1,…

Browse structure collections

About this viewer

MolViewer shows 8RLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.