8S4Y: APP-talin (F2F3) chimera

Crystal structure of an APP-talin (F2F3) chimera. Determined by X-ray diffraction at 2.7 Å resolution. Released 16 Oct 2024.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,722
Mol. weight: 24.14 kDa
Released: 16 Oct 2024

Explore 8S4Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8S4Y contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	210-224	15
α-helix	232-247	16
α-helix	262-264	3
α-helix	268-273	6
α-helix	276-285	10
α-helix	291-303	13
β-strand	311-318	8	1
β-strand	325-332	8	1
β-strand	336-340	5	1
β-strand	347-352	6	1
α-helix	353-355	3
β-strand	358-361	4	2
β-strand	366-369	4	2
α-helix	371-373	3
β-strand	378-380	3	2
β-strand	381	1	1
α-helix	385-399	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C31	A	protein	17	Mus musculus	P12023 (AlphaFold model)
Talin-1	B	protein	192	Mus musculus	P54939 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8S4Y_1 C31 (chains A)
GIDPFTQNGYENPTYKF

Sequence of entity 2 (B), FASTA

>8S4Y_2 Talin-1 (chains B)
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPK
EYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPR
LLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQI
AQLIAGYIDIIL

Primary citation

The structure of an amyloid precursor protein/talin complex indicates a mechanical basis of Alzheimer's disease. Ellis, C., Ward, N.L., Rice, M. et al. Open Biol (2024) 14:240185-240185. DOI 10.1098/rsob.240185 · PubMed

Other PDB entries of the same protein (UniProt P12023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MYK 1.6 Å, Structure of Pyroglutamate-Abeta-specific Fab c#17 in complex with murine Abeta-pE3-18PEGb
4YN0 2.2 Å, Crystal structure of APP E2 domain in complex with DR6 CRD domain
7MRN 3.5 Å, Mouse CNTN5 APP complex
8BG9 3.5 Å, Murine amyloid-beta filaments with the Arctic mutation (E22G) from APP(NL-G-F) mouse…
2ROZ Structure of the C-terminal PID Domain of Fe65L1 Complexed with the Cytoplasmic Tail of…

Browse structure collections

About this viewer

MolViewer shows 8S4Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.