8SDX: ATAD2B bromodomain

ATAD2B bromodomain in complex with histone H4 acetylated at lysine 5 with Serine 1 mutation to Cysteine. Determined by X-ray diffraction at 2.69 Å resolution. Released 5 Jun 2024.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,342
Mol. weight: 34.44 kDa
Released: 5 Jun 2024

Explore 8SDX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8SDX contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	952-976	25
α-helix	979-983	5
α-helix	986-988	3
α-helix	995-998	4
α-helix	1005-1013	9
α-helix	1020-1037	18
α-helix	1043-1066	24
α-helix	1069-1082	14

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	954-975	22
α-helix	979-983	5
α-helix	986-987	2
α-helix	995-998	4
α-helix	1005-1013	9
α-helix	1020-1037	18
α-helix	1043-1066	24
α-helix	1069-1082	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase family AAA domain-containing protein 2B	A, B	protein	136	Homo sapiens	Q9ULI0 (AlphaFold model)
histone H4S1CK5ac	C, D	protein	15	Homo sapiens	P62805 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8SDX_1 ATPase family AAA domain-containing protein 2B (chains A, B)
GPLEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVI
TKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDP
EFNKLCEEIKEARIKR

Sequence of entity 2 (C, D), FASTA

>8SDX_2 histone H4S1CK5ac (chains C, D)
CGRGKGGKGLGKGGA

Primary citation

Impact of Combinatorial Histone Modifications on Acetyllysine Recognition by the ATAD2 and ATAD2B Bromodomains. Phillips, M., Malone, K.L., Boyle, B.W. et al. J Med Chem (2024) 67:8186-8200. DOI 10.1021/acs.jmedchem.4c00210 · PubMed

Other PDB entries of the same protein (UniProt Q9ULI0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UK5 1.4 Å, Crystal structure of the bromodomain of human ATAD2B in complex with histone H4S1(ph)K5ac
8UHL 1.92 Å, ATAD2B bromodomain in complex with histone H4 acetylated at lysine 12
3LXJ 2.33 Å, Crystal Structure of the Bromodomain of Human AAA domain containing 2B (ATAD2B)
6VEO 2.4 Å, ATAD2B bromodomain in complex with 4-({[(3R,4R)-4-{[3-methyl-5-(5-methylpyridin-3-yl)-2-o…
2DKW Solution structure of the bromodomain of human protein KIAA1240

Browse structure collections

About this viewer

MolViewer shows 8SDX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.